KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1186Help
Entry
YN1551_1186       CDS       T00902                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1054613..1056034)
Genome map
AA seq 473 aa AA seqDB search
MQVIRKPTRMLSGVTIVSIMTHPHSCPHGKCVFCPGGVDVDTPQSYYGREPTLMRAIEND
YDPFHQVQSRLRQYVENGHTPSKVELIIMGGTFLSLPIDYQDWFVTYALEAMNRFPSYDK
PSFVYLEDAQVKNEKAEVRCVGMTIETKPDWAKEWHADQMLRLGATKVELGVQTVYDDIL
KFTNRGHTVKDSIESTRILKDSGFKVVYHVMLGLPKSDLDKDLEAFKTIFSDPNFRPDML
KIYPTLVVETAPLANLWRRGLYKPYGTETLIELISEMYRYIPKWVRVMRIQRDIPANVIL
DGNKKGNLRELVEKKVLEKGIKINEIRFREVGMMWQHRGLLPDHTKIHLYKEVYEASEGT
EIFLSFEDEKEILIGYLRLRITSNKAHRKEIDGKTAIVRELHVYGIEVPIGSWDELGFQH
RGYGSKLLSEAEKIAREEFDMRKISVLSGIGAREYYAKRGYVKEGPYMSKQLI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaataaggaaaccaactagaatgctttctggcgttacgatagtatcgataatg
actcacccgcattcttgtccgcatggaaagtgtgtattctgtcccggaggagtagatgtg
gataccccccaaagctactatggtagagaacccactttaatgagggcaatagaaaacgat
tatgatccattccatcaagtacagtcaagattaagacaatatgttgagaatggacatact
ccaagtaaagtagagttaataataatgggtggtactttcctatcattacccatagattat
caagattggtttgtgacctatgccttagaggctatgaatagatttcctagttatgataaa
ccttcttttgtatatttagaagatgcacaagtgaaaaacgaaaaggcagaagtacgttgt
gtaggaatgacgattgaaacgaaaccggattgggctaaggagtggcacgcagatcaaatg
ctaagattaggtgcaaccaaagttgaattaggagtgcaaactgtatacgatgacatttta
aagttcaccaataggggtcataccgtaaaagattccatagaatctactagaatactgaag
gattcagggttcaaagtggtctatcatgtaatgcttggtcttcctaaatcagatcttgat
aaggatctggaggcatttaagacaatattttctgatcctaattttaggccggatatgttg
aaaatatatcctaccttagtagttgaaactgcgccgttagcgaatttatggagaagggga
ttatataagccttatggtacggagactttaattgaattaatatctgaaatgtatagatat
attcctaaatgggttagagtgatgagaatacaaagagatattcctgctaatgtaatctta
gatggtaacaaaaagggaaacttaagagaattggtagagaaaaaggtcttggagaaagga
attaagattaatgaaattagatttagggaagttgggatgatgtggcaacataggggatta
ttaccagatcatactaaaattcatctttacaaggaagtttatgaagcaagtgaaggtact
gaaattttcctatcttttgaggatgaaaaagagattttaataggttatttacgattaaga
ataacatcaaataaggctcatagaaaagagatagatggaaagacggccatagtaagagaa
cttcacgtatacgggatagaagtacctataggaagctgggatgaattgggtttccaacat
agggggtatggaagtaagttattaagcgaagctgaaaagattgcgagagaggaattcgat
atgcggaaaatttctgttttatctggaataggtgctcgagaatactatgctaaaagaggc
tatgtaaaagaaggtccttatatgtctaagcagttgatttga

DBGET integrated database retrieval system