KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1297Help
Entry
YN1551_1297       CDS       T00902                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sin01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sin00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1151191..1152387
Genome map
AA seq 398 aa AA seqDB search
MISYSLPNERPNDFSRVIPVVRDIIESVKARGDNALYQLTEKLDKVKINNIKVSEEELKT
QASKLDPKVKQAIDVAYEQLKAFHEMLVPPNIGGGYQGISFGVVWRSIEKIGIYVPSGKY
SYPSTLLMAGIPAKVAKVKEIYVASPPNQEGSVNPALAYVAIKLGVNDVYKVGGAQAIAA
LAYGTESVRKVYKIVGPGNVYVQAAKFLVSNVVGIDGIEGPTELVIIADETAKAEHVVLD
MKAQAEHGPDTYIVLLSNDDELLKKVEEKIMDDKKIYYIIKTKNIDEAIEIANKIAPEHL
SLYVKDAYTLMDKIVNAGAISLGNTPPAIIDYVAGPNHILPTNGWARIRGGVTVYDFIKP
TMYANVRDINKQLLEASISLANYEGFVIHGKSIGVRYE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctatagtttaccaaatgagagacctaacgattttagcagagtgattccagta
gttagagatattattgaatctgttaaggctaggggagataacgcgttatatcagctaact
gaaaaattggataaggtgaagataaataacatcaaggtaagtgaagaagaattaaaaacg
caagcttctaagttagatcctaaagttaagcaagctatagatgtggcttatgagcaatta
aaagcatttcacgaaatgctagttcctccaaatattggagggggttatcaaggaatatca
tttggagtagtttggagaagtatagaaaagattggaatatatgttccttccggtaaatat
tcctatccatcaaccttactaatggctggaataccagcaaaagtagctaaggtaaaggaa
atttacgtagcctctcctcctaatcaagaaggatcagtaaatccggctttagcttatgtt
gcaattaagctaggagtaaatgacgtttataaggtaggtggtgcacaagcaatagctgct
ttagcttatggtactgagagtgtaaggaaagtttacaagattgtaggaccgggtaatgtt
tatgtccaagctgcgaagttcctagtgagtaacgttgtcggaattgatggaattgaagga
ccaactgaattagtaataatagcagatgagactgcaaaggctgaacatgttgtattagat
atgaaggcacaggctgaacatggccctgatacgtatatagtactcttatctaatgatgac
gaacttctaaagaaggttgaagagaaaataatggatgataaaaaaatatattacataata
aaaactaaaaatatagatgaggctatagaaattgcaaataaaattgccccagagcatcta
tccttatatgttaaagacgcatataccttaatggataaaatagtaaatgcaggagcaata
agcctaggaaacacacctccagcaataatagattatgtagctggtcctaatcatatttta
cctactaatggctgggctagaattagaggaggcgttactgtttacgattttataaagcca
acaatgtacgctaatgtccgtgatataaataaacaattacttgaagcatctatttcttta
gcaaactatgaaggattcgtaattcatggtaaaagtataggtgtccgatatgagtaa

DBGET integrated database retrieval system