KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1531Help
Entry
YN1551_1531       CDS       T00902                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YN1551_1531
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YN1551_1531
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YN1551_1531
Enzymes [BR:sin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YN1551_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1330623..1331900
Genome map
AA seq 425 aa AA seqDB search
MVKEDEILPKYWYNIIPDLPKPLPPPRDPQGVDFSRIDLLRSILPKEVLRQQFTIERYIK
IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK
EEGIDHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS
PTNLTEYGKKMLETNPQHPGSLGIAMSEAIEYALKNEFRYLVGSVLDVVLLHQSVIGQET
ITQLDLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKYDF
PDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLAKEGIVEWREYNEREIFDA
AKIFMENQGIVPAPESAHAIKAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESMMKR
LNGNG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagacgagattttgcctaagtactggtacaatataattcccgatctgcct
aaacccttgcctcctccaagggatccacaaggggtagatttctcgagaattgatttatta
agaagtatactacctaaggaggtattaaggcaacaattcacaatagaaagatacataaag
atccctgaggaagtaagagatagatatttatcgataggaagaccaacaccattatttaga
gctaaaagattagaggagtacttaaagacaccagcaagaatctactttaaatatgaaggc
gctacacctactggatctcataagataaatacagcaattcctcaagcatatttcgcaaaa
gaagagggaattgatcacgtagttactgaaactggagcaggtcaatggggaactgcagta
gcacttgcagctagtatgtataatatgaaaagtactatcttcatggtaaaggtaagttat
gaacaaaaaccgatgagaaggagcataatgcaattatatggggctaatgtttatgcaagc
cccacaaacttaactgaatacggtaagaagatgttagagacaaatccacagcatcctgga
tcactaggtatagcaatgagtgaggcaatagagtatgctcttaagaacgaatttagatat
ttagtaggtagcgttttagatgtagtacttttgcatcaaagcgttattggtcaagagact
attacccaattggatttgttaggagaagacgctgatattctaattggatgcgtaggaggt
gggagcaattttggtggttttacatatccctttatcggaaacaagaaaggcaaacgctac
attgcagtaagttctgcagaaattccaaagtttagtaaaggtgaatataagtacgatttt
ccagactctgctggattattacctttagtgaaaatgataactttaggtaaagattacgtt
cctccgccaatatatgcaggcgggttaagatatcatggtgtagcaccaacattaagtttg
ttagcaaaggagggtattgtggaatggagagaatataatgaaagggagattttcgacgcc
gctaagatatttatggagaatcaaggtattgtaccagctccagaatcagcccatgcaata
aaggcagtggtcgatgaagctatagaagctaggaagaataatgagcgaaaagtcatcgtc
tttaatctaagtggacatggattgttggatctatcaaattacgaatccatgatgaaaagg
ttgaatggaaatgggtaa

DBGET integrated database retrieval system