KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1537Help
Entry
YN1551_1537       CDS       T00902                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YN1551_1537 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YN1551_1537 (trpC)
Enzymes [BR:sin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YN1551_1537 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1336090..1336836
Genome map
AA seq 248 aa AA seqDB search
MPRYLKGWLKDVVQLSLRRPSFRTSRQRPIISLNKRILEFNVRNVTAIIAEYKRKSPSGF
DVERDPIEYAKFMEKYAVGLSVLTEEKYFNGSYEILRKIASSVSIPILMKDFIVKESQID
DAYNLGADTVLLIVKILTERELESLMEYTRSYGMEPLVEINDEKDLEIALRIGAKFIGVN
SRDLETLEINKENQRKLLSMIPSDVIKVAESGISERNEIEELRKLGVNAFLIGSSLMQNP
EKIKEFIL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttatcttaaaggatggcttaaagacgtcgtacaattatctttaagaaggccc
tcgtttaggacttcaagacaaagaccgattatttccttaaataaaagaattttggaattt
aatgtgcgcaatgtcacagctataatagctgaatataagcgcaaatctccctctggattc
gatgttgaaagagatccgatagaatatgcaaagttcatggaaaagtatgcagtaggtctt
agcgtactaactgaggaaaagtactttaatggttcatatgaaattttgagaaagatagcc
agttcagtttcaatccccatattaatgaaggattttattgtcaaggaatcacaaattgat
gatgcgtataacttaggtgcagatactgtattgctaatagtcaaaatacttactgaaaga
gaattagagagtttaatggaatataccagaagttatggtatggaaccattggtagagatt
aatgacgagaaggatttagaaatagcactaaggataggggccaagtttataggagttaat
tcaagagatctagaaacccttgagataaataaggagaatcagagaaagcttctatcaatg
ataccatcagatgtaataaaggtggcagaaagtggaatttctgagaggaatgaaatagag
gaattgagaaaattaggtgttaatgctttcctaattggatcctcactaatgcaaaaccca
gaaaagattaaagaatttatactataa

DBGET integrated database retrieval system