KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1611Help
Entry
YN1551_1611       CDS       T00902                                 

Definition
GTP-binding signal recognition particle SRP54 G-domain
Orthology
K03106  
signal recognition particle subunit SRP54
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Protein export
Bacterial secretion system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:sin03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:sin03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1404581..1405924
Genome map
AA seq 447 aa AA seqDB search
MLENIRDAVRKFLTRSTPYEKAVDEFIKELQKSLISSDVNVKLVFSLTAKIKERLNKEKP
PSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFY
KRRGYKVGLVAADVYRPAAYDQLLQLGNQIGVPVYGEPNNQNAIEIAKKGVDTFVKNKMD
IIIVDTAGRHGYGEETKLLEEMKEIYEALKPDDVILVIDASIGQKAYDLASRFHQASPIG
SIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEIFNAKRYVSRILGMGDIESI
LEKVKGLEEYEKIQKKMEDVMEGKGKLTLRDVYAQIMALRKMGPLSKVLQHIPGLGVMLP
TPSEDQLKLGEEKIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEW
YNNMNKLLKMVKRRRGSIDKLFGGKIG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaatataagggatgccgtaagaaagttccttacaaggtctacaccatacgag
aaggctgtagatgagtttataaaagaacttcagaagtctcttatttcatccgatgtaaat
gtaaagctagttttttcattaaccgccaagattaaagaaaggctaaataaggaaaagcct
ccatctgttttagaaaggaaggaatggttcatttctatagtttatgatgaactttccaaa
ttgtttggaggagataaggaacctaatgttaatcccaccaagttaccctttataataatg
ttggttggtgttcaaggaagcggaaaaacaaccactgcagggaaattagcttatttctac
aaaagaagaggttataaagtaggtttagtggcggctgacgtgtataggccagctgcttat
gatcaattgttgcagttaggtaatcaaattggagtaccagtatatggagaaccaaataat
caaaacgccatcgagatagctaaaaaaggagttgatacgtttgtaaagaacaaaatggat
ataatcatagtagacactgcaggacgacatggatatggtgaagagactaagcttctagag
gaaatgaaggagatatatgaggcattgaaacccgatgatgtaatcttggtcattgacgcg
tccattggacaaaaagcctatgatttagcatctagattccatcaagcaagtccaatcggt
tctataataataacgaagatggatggcactgcaaagggaggcggagcgttgtcagcagta
gcagctactggagctacgataaagtttataggtactggagaaaaaatagacgaattagaa
atatttaatgccaagagatatgtttctaggatattagggatgggagatatagaatcaatt
ctagagaaagttaaaggattagaggaatacgagaaaatacaaaagaaaatggaagatgtt
atggaaggtaaaggaaagctaacacttagagatgtttatgcacaaatcatggctttgagg
aaaatgggtcccctttctaaagtgctacaacatatcccgggtttaggtgttatgcttccc
acccctagcgaagaccaattgaaattaggagaggaaaagattaggagatggctagcagcc
ttaaattctatgacgtataaggaattggaaaatcctagtataattgataagtcgagaatg
agaagaatagctgaaggatcaggattagaggttgaagatgtaagagaacttttagagtgg
tataacaacatgaataagcttttgaaaatggtaaaaagaaggaggggcagtattgataaa
ctcttcggagggaaaatcggataa

DBGET integrated database retrieval system