KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1779Help
Entry
YN1551_1779       CDS       T00902                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00260  Glycine, serine and threonine metabolism
sin00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sin01100  Metabolic pathways
sin01110  Biosynthesis of secondary metabolites
sin01130  Biosynthesis of antibiotics
sin01230  Biosynthesis of amino acids
Module
sin_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YN1551_1779
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YN1551_1779
Enzymes [BR:sin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YN1551_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACP48850
JGI: SislY21779
UniProt: C3NI90
Position
1565299..1566588
Genome map
AA seq 429 aa AA seqDB search
MAMRIRIDLPQDEIPAQWYNILPDLPEELPPPQDPTGKSLELLKEVLPSKVLELEFAKER
YVKIPDEVLERYLQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVY
YAKLDNAKFVTTETGAGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEV
HPSPSDLTEFGRQLLAKDSNHPGSLGIAISDAVEYAHKNGGKYVVGSVVNSDIMFKTIAG
MEAKKQMELIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRKYIASGSSEVPKMT
KGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLMSKGIVQARDY
SQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLG
NYASVLFKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagaataagaatagatttgcctcaagatgaaatacccgcacaatggtataat
atcctaccagacttaccggaggaactacccccgccacaagatcccactggcaaatcctta
gaactattgaaggaagttttaccgagcaaggtgctggagttagagttcgctaaggaaaga
tacgtaaaaattccagatgaggttctggagagatatttacaagttggaagaccgactcca
ataattagggcaaaaaggttagaggagtacttaggaaataatatcaaaatctatctgaag
atggagagctacacttacactggttctcacaaaatcaacagtgccttagcacatgtatat
tacgctaaattggataacgcgaaattcgttacgacagaaactggagctggtcagtgggga
tcatcagttgcactagcctcagccctatttaggatgaaagcacacatatttatggttagg
actagctattatgcaaagccttacagaaaatatatgatgcagatgtatggagcggaagtt
catccttctccttcagatttaacagaattcggtagacaattattggccaaagactccaat
catcctggatctttaggcatcgcaataagtgatgcagtagaatatgctcataaaaacggt
ggaaaatacgttgtaggtagtgtggtaaattcagatataatgtttaaaacgattgccgga
atggaggctaagaagcaaatggaactgattggtgaagatccagattacattataggagta
gtaggagggggatcaaattacgcagcattagcttatccattcttaggagatgagctgagg
agtggaaaggttaggaggaagtatattgcctctggatcctcagaagttccaaaaatgact
aagggtgtttataaatacgattatccagacactgcgaaattgttgccaatgctaaaaatg
tacacaatagggtcggacttcgtaccacctccagtttatgcaggtgggctaagatatcat
ggagtagccccaactctcagtctattaatgagcaagggaattgtacaagcaagagattac
tctcaagaggagtcgttcaaatgggctaaattattctcagaactggagggatatatacca
gctccagagacttctcacgcattgccaatattggctgaaatagctgaagaggctaagaag
agcggagaaaggaagacagtactggttagcttctctgggcatggactactagatttgggc
aactacgcctcagtgttatttaaggagtag

DBGET integrated database retrieval system