KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1878Help
Entry
YN1551_1878       CDS       T00902                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00010  Glycolysis / Gluconeogenesis
sin00620  Pyruvate metabolism
sin00640  Propanoate metabolism
sin00680  Methane metabolism
sin00720  Carbon fixation pathways in prokaryotes
sin01100  Metabolic pathways
sin01110  Biosynthesis of secondary metabolites
sin01120  Microbial metabolism in diverse environments
sin01130  Biosynthesis of antibiotics
sin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YN1551_1878
   00620 Pyruvate metabolism
    YN1551_1878
   00640 Propanoate metabolism
    YN1551_1878
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YN1551_1878
   00680 Methane metabolism
    YN1551_1878
Enzymes [BR:sin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YN1551_1878
Lipid biosynthesis proteins [BR:sin01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YN1551_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACP48938
JGI: SislY21878
UniProt: C3NIH8
Position
complement(1663601..1665097)
Genome map
AA seq 498 aa AA seqDB search
MASYEEVRRSFSWSEVIRYLDENPLDVLTSHDGIAVKRFTKNAMEEISFSDLKRKALRLA
LYLKEFHNIKKGDVIAILASKKIQQIIVLLATLSLGAIYQPLFTAFGPEAIKMRTRDVKP
KIIFCQDDQKDKINDAILFSKFDELLSYGELKEIEKINWDDAIILLYTSGTTGTPKGALI
AKRLFLNIYVYMKYGIGVRENDVFWNPADPGWAYGLYYGIIGPLMFGKTIIFLDEPFNPE
RTMEFMEENKVTNFAFAPTAYRMIAGTVKKKYDLVLERASSAGEPLNPEVIRWFMDKYNV
TIKDHYGQTEVGMVVYNGWGYDAKVKIGSMGLPAPGYEVDIIEDIIAVKRDSPGFHFLGY
LNNPEKTKESFRGDWYLTGDNAYKDEEGYLWFVGRKDDVVKVSGYRIGPFEVESVLLEFP
AVLESAVVADEDPIRGHVLHAYIVLKSGYTPSEELKKEIIDFVNTKYSRHVHLERVDFVD
KLPKTESGKIQRYLLRKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctagttatgaagaagttaggagaagtttttcgtggagtgaggtaattagatattta
gacgagaacccattagacgttttgacttctcatgacggtatagcagttaagagattcact
aagaacgctatggaggagataagcttctcagatcttaaaagaaaggcattaagacttgcc
ttatatctcaaggagtttcataacattaaaaagggtgatgtaatagcaatattagcttca
aagaagattcaacaaatcatagtacttttagcaactctctccctaggagcaatttatcaa
ccattatttactgcatttgggccagaggcaattaagatgaggactagagatgtaaaacca
aaaattatcttttgtcaagatgaccaaaaggataagataaatgatgcaatactcttctcc
aagtttgatgaattattaagttacggtgaattgaaagagattgaaaagataaattgggat
gatgcaataattttactttacacttctggtactacgggaacacctaaaggggccctaatc
gctaagaggctatttcttaacatttatgtctacatgaaatatggtataggtgttagggaa
aatgacgtgttttggaaccccgcagatcctggatgggcttatgggctatattatggtata
ataggaccgctaatgtttgggaaaactataatctttcttgacgaaccatttaacccagaa
aggacaatggagttcatggaggaaaataaggttactaattttgctttcgcacctacggca
tatagaatgatagctggaacggttaagaagaagtatgatttagtattggaaagagcgagt
tctgcaggtgaaccacttaacccagaagttataagatggtttatggataagtacaatgtt
actatcaaggatcattatggacaaactgaagttggaatggtagtttataatggctgggga
tatgacgcaaaagtaaaaatagggagtatgggactacctgcacctggttatgaggtcgat
ataatagaggatattatagctgtcaagagagattctccaggtttccacttcttgggatat
ctaaacaatccagagaagaccaaggaatcatttcgaggcgattggtacttgactggtgat
aatgcgtataaagatgaggaaggatatttatggtttgttggaaggaaggacgatgtggtt
aaggtatctggttacaggataggtccatttgaagttgagagcgtacttctagaatttccc
gcagtactagaatctgctgttgttgccgatgaagatccaatacgaggacatgtattacat
gcttatattgtactcaaaagtggatatactccaagtgaggaactaaagaaggagattatt
gattttgtaaatactaaatattctaggcacgtacatctagaaagggttgactttgttgat
aaattgccaaagactgagagtggtaaaatacaaagatatctacttagaaagaaataa

DBGET integrated database retrieval system