KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_2265Help
Entry
YN1551_2265       CDS       T00902                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sin01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sin00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2018798..2020009)
Genome map
AA seq 403 aa AA seqDB search
MILDEIVEASKDEIVEFLKQLIRIPTENPPGLNYDKIISVLRDKLEEFGYKTEIIEGNKE
FVKFGNGNRPNLVGYLGNGNVRIAFNGHYDVVPAGEGWSINPYEGIEKDGKVYGRGASDM
KSGIVAQIYAVEMLKRAKLLPSNVKIIQTIVPDEETVGNKNAGTYCLREIYKKNADYVIF
TEPTGPDNICNGHRGAIWAVVKIYGKKSHGGFPQLGIDAVKAVAIMIERLYSSLSNITSK
YNIVPEAGKKPSILVGTVKCGTWVNTVADYCEFSIVRRLIPEERINEVRESILRLLRDVS
SETGVKFDYDEFYAVDTVVSEDGRLIDALRKAIREVRGVDPNVVLSAGTFDIRFTVSEGI
KSINYGPGRIELAHSTDEFVYVKDLLDSIKALGRVLLEVAKGS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgagatcgttgaagcctctaaggatgaaattgtggagttcttaaagcag
ttaataaggatcccaactgagaatcctccaggcttaaattacgataagataattagcgtg
ttgagggataaattagaagagtttgggtataaaacggaaattattgagggtaataaagag
tttgtcaagttcggaaatggcaatagaccaaatctagtaggttatttgggtaatggcaac
gtaaggattgcgtttaatggacattacgatgttgttcccgccggtgagggatggagtatt
aacccttatgaggggattgaaaaagatggcaaggtttacggaagaggagcttctgacatg
aagtctggaatagttgcgcaaatttacgctgttgaaatgttgaagagagctaaactactc
ccctctaacgtgaaaatcatccagaccattgtcccagatgaggagactgtaggcaataaa
aatgctggtacttattgtttaagggaaatctacaagaaaaacgcagattacgtaatattc
acagaacctactggaccagataacatttgcaatggtcataggggtgcaatctgggctgtg
gttaaaatatatgggaagaaaagtcatggaggttttcctcaattaggaattgacgcagtc
aaggctgtagcgattatgattgaaagactttactcgtctttatccaacattacctcaaag
tacaacattgtaccagaggctggtaagaaaccgtcaatattagttggtactgttaagtgt
ggtacgtgggttaacactgtagcagactattgtgagttcagtatagttaggagattaatc
ccagaggagaggattaatgaggttagggagagcattttacggttgttaagggatgtgagt
agtgagactggcgttaagtttgattacgatgagttttacgctgtcgatactgtagtaagt
gaggatgggagactaatagatgctctgagaaaggctataagggaggttaggggagttgat
cccaatgttgttttatctgcagggactttcgatattaggtttaccgtaagtgaggggata
aagagtattaattacggtccgggtaggattgagttagcacattctacagatgagttcgtt
tacgttaaagatttattggattcaataaaagcgttaggaagagtactattggaggtggct
aaaggaagttag

DBGET integrated database retrieval system