KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_2349Help
Entry
YN1551_2349       CDS       T00902                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00630  Glyoxylate and dicarboxylate metabolism
sin01100  Metabolic pathways
sin01110  Biosynthesis of secondary metabolites
sin01120  Microbial metabolism in diverse environments
sin01200  Carbon metabolism
Module
sin_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YN1551_2349
Enzymes [BR:sin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YN1551_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACP49324
JGI: SislY22349
UniProt: C3NK81
Position
complement(2101953..2103266)
Genome map
AA seq 437 aa AA seqDB search
MNIRDKWSEEEKRLEYEWSEDPRWKGIKRNYKPSDVVKLRGSIRIEYSIAKLASHKLWNL
LNTEPYIATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVKRLNNALLRADQISWSEGKRDIDYLLPIVADAEAGFGGPIHAFELTKALIEAGAAGVH
FEDQLASEKKCGHLGGKVLIPISAFIRVLNAARLASDVLGVPTILIARTDALNAKYLSND
VDETDNQFLTGKRTSEGYYEIRGGIEYAIARGLAYAPYADLLWFETSKPDLEEARQFAEA
IHTHYPGKLLAYNLSPSFNWKKFMDDSKISRFMNELGEMGYKFQFITLAGWHLINYHTFK
LARAYRNEGMPAYVRLQESEFQAQAEGYTAVSHQREVGTDYFDLVLTIASGGEASTTAME
GSTEAEQFVEAKQKVLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgagataaatggagtgaagaggaaaaaagacttgaatacgagtggtccgaa
gatccaaggtggaaaggaataaagagaaattataagccctcggatgtggtaaaattaagg
ggatctatcagaattgagtatagtatagctaaattagcctctcataaactttggaacttg
ctaaatactgagccctatatagcaacatttggggcattaacgggttcccaagcagttgaa
atggcaaaagcgggccttaaagcaatttacgtaagtggatggcaagtagctgctgataac
aatttatcaaatcaaacttatccagacttgagcttatatccatctaacagtgttccaaac
ttagtaaagaggttaaataacgctcttttaagggctgaccaaatatcttggagtgagggt
aaacgcgatatcgattacttactgcctattgttgcagatgctgaagctggtttcggtggt
ccaattcacgctttcgaactaacaaaagccttaatagaggcaggggctgcgggcgtacat
tttgaagatcaattagcatcggagaaaaaatgtggacatttaggaggaaaagttctaatt
ccaataagtgcatttataagagtactaaacgctgcaagactagcatctgacgtattagga
gtacccacaatactaatagcaaggacagacgcactaaatgcgaaatacttatctaacgat
gtagatgagactgataatcaattcttaactggaaaaagaacatcagagggatattatgag
attaggggaggtatcgaatacgctattgccagaggattagcttatgcaccctatgcggac
ctattatggtttgagacttctaagccagatttggaagaggctagacaatttgcagaggct
atccacactcattaccccggtaagttgttagcgtataacctatccccctcatttaactgg
aagaaatttatggatgattccaaaatcagtaggttcatgaacgaattaggagaaatgggc
tataaattccaattcataacccttgcaggttggcacttaattaactaccatacattcaaa
ttggcgagagcatatagaaacgaaggaatgccagcatatgtaagactacaggagtcagag
ttccaggctcaagcagaaggatatacggccgtaagtcatcagagagaggttggaacagat
tacttcgacctagtgttaacaatagcatctgggggagaagcgtccactactgcaatggaa
ggttctactgaagctgaacagtttgtagaggcaaaacagaaagtattgaaataa

DBGET integrated database retrieval system