KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_2406Help
Entry
YN1551_2406       CDS       T00902                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YN1551_2406
   00052 Galactose metabolism
    YN1551_2406
   00500 Starch and sucrose metabolism
    YN1551_2406
   00520 Amino sugar and nucleotide sugar metabolism
    YN1551_2406
Enzymes [BR:sin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YN1551_2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2158740..2159501
Genome map
AA seq 253 aa AA seqDB search
MQAVITAAGLGTRMLPISKEIPKEMLPIPNNGELKPIIQVIFEQLYDQGVREFIIVVSKS
KRVIEDYFTPDYYFLEYLESEGKTKQANSLKNFYKKIEESNIVFLTQYEPKGFGDAVLRT
EPYVRDEFLVVAADTIVYDLNIKLMVTNSFLVTEVEDPRPYGVVIADKDGKVIDVEEKPK
VPKSNLIIVPYYYFDRRIFQALKEVRFQKELQLTDGIKNLIRKGVNFKAIKVNNVYDLGN
FEGYFNYLKGNIK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgtaataactgctgctggattaggaactagaatgttgcctataagtaaggag
atccctaaggaaatgttgcccattcccaataatggtgagttgaagcctataattcaagtc
atttttgaacaactttacgatcaaggagtaagagagtttattatagtggtgagtaaaagt
aagagagtaatagaagattattttaccccagattattatttcttggaatatttagaaagt
gaagggaaaactaaacaagctaatagcttaaagaatttttataaaaaaattgaagaaagt
aatatagtgtttctaactcaatacgaacctaaaggttttggagatgcggtcttaagaaca
gaaccatatgttagagatgaattcttagttgttgctgctgatactatagtttacgatctt
aatattaaacttatggtaactaattcttttctcgttactgaagtagaggatcctagacct
tatggtgtcgtgattgcagataaggatggaaaggtaattgatgtagaggaaaagcctaag
gttccaaaatctaatcttataatagttccttattactactttgataggagaatatttcaa
gctttgaaagaggttcgctttcaaaaagagctacagttaactgacggtattaaaaattta
ataaggaagggggtcaatttcaaagctataaaagttaataatgtttacgatttaggtaat
tttgagggatacttcaattatttaaaagggaatataaaatga

DBGET integrated database retrieval system