KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_2406Help
Entry
YN1551_2406       CDS       T00902                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sin00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sin00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sin00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sin00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2158740..2159501
Genome map
AA seq 253 aa AA seqDB search
MQAVITAAGLGTRMLPISKEIPKEMLPIPNNGELKPIIQVIFEQLYDQGVREFIIVVSKS
KRVIEDYFTPDYYFLEYLESEGKTKQANSLKNFYKKIEESNIVFLTQYEPKGFGDAVLRT
EPYVRDEFLVVAADTIVYDLNIKLMVTNSFLVTEVEDPRPYGVVIADKDGKVIDVEEKPK
VPKSNLIIVPYYYFDRRIFQALKEVRFQKELQLTDGIKNLIRKGVNFKAIKVNNVYDLGN
FEGYFNYLKGNIK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgtaataactgctgctggattaggaactagaatgttgcctataagtaaggag
atccctaaggaaatgttgcccattcccaataatggtgagttgaagcctataattcaagtc
atttttgaacaactttacgatcaaggagtaagagagtttattatagtggtgagtaaaagt
aagagagtaatagaagattattttaccccagattattatttcttggaatatttagaaagt
gaagggaaaactaaacaagctaatagcttaaagaatttttataaaaaaattgaagaaagt
aatatagtgtttctaactcaatacgaacctaaaggttttggagatgcggtcttaagaaca
gaaccatatgttagagatgaattcttagttgttgctgctgatactatagtttacgatctt
aatattaaacttatggtaactaattcttttctcgttactgaagtagaggatcctagacct
tatggtgtcgtgattgcagataaggatggaaaggtaattgatgtagaggaaaagcctaag
gttccaaaatctaatcttataatagttccttattactactttgataggagaatatttcaa
gctttgaaagaggttcgctttcaaaaagagctacagttaactgacggtattaaaaattta
ataaggaagggggtcaatttcaaagctataaaagttaataatgtttacgatttaggtaat
tttgagggatacttcaattatttaaaagggaatataaaatga

DBGET integrated database retrieval system