KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_2663Help
Entry
YN1551_2663       CDS       T00902                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YN1551_2663
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YN1551_2663
  Lipid metabolism
   00071 Fatty acid degradation
    YN1551_2663
  Amino acid metabolism
   00350 Tyrosine metabolism
    YN1551_2663
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YN1551_2663
   00626 Naphthalene degradation
    YN1551_2663
Enzymes [BR:sin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YN1551_2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2365457..2366542)
Genome map
AA seq 361 aa AA seqDB search
MKAARLVEFQKPLKIEDLEVPKVGKGDVLLKVISCGICRSDWHLWRGDPALVAYMQWSGG
KLPITQGHEVYGEVVEVGESVAKLKNGDKVVMPASSTGDNRTCKYCMEGDSNVCDHLVIA
GYGINGCFAEYMLVPERSAIDLVKVPDGIKPEWAALSSCGFGTSWNAFTMKTNLKPGDMV
VTIGAGGMGLSGIVIANALGAKVIAVDVNERSLEKAKILGSIETYKYSGKSEELNEIVED
IMKKYGSVDVVYDTTGIPEAVIPFLPLLRVHGTLLLAGLMMKGKETFPLPADLVVAREIR
IQGVLMLPAQKFDTIFKLMKEGKINLDPVTYKTISIYDVNDAYKEMSEYKNAGRIIINKF
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctagattagtggaatttcaaaagcctctgaagatagaggatctcgaagtt
cctaaagttggaaaaggagatgtgcttctaaaagtgataagctgtggaatatgtagatca
gattggcatctatggcgtggagatcctgctttggtagcatatatgcagtggagtggtggt
aagttaccaataactcaaggtcatgaggtttatggagaagtcgtagaggtcggagagagt
gtagctaaattgaaaaatggagataaggtagtcatgcctgcttcttctaccggagataat
aggacatgcaaatactgtatggaaggagattcaaatgtttgtgatcacttggtaatagct
ggttatggaattaatgggtgctttgctgagtacatgttagtcccagagaggtcagcaatt
gatctagttaaagtaccagatggaataaagccagagtgggctgctctaagttcttgtggt
tttggaacttcatggaacgcgtttacaatgaagactaatttaaagcccggtgacatggtg
gtcacaatcggagcaggagggatgggtttgagtggtatagtaatagctaacgctcttggt
gctaaagtaatagctgtagacgttaacgaacgatctttagagaaagctaaaatattaggt
agcattgagacttataaatattctggtaagtctgaagaattgaatgaaatagtagaggat
attatgaagaagtatggttcagtggacgtagtgtatgatactacaggaattccagaggct
gtcataccgtttttacctctccttagagtgcatgggacattactattagcggggcttatg
atgaaggggaaagagacttttccattgccagcagatttagtggtagcaagggaaatcaga
atacaaggagtattaatgttaccagctcaaaaattcgatacaatatttaaattaatgaaa
gaaggaaagattaatctagatccagttacgtacaagactataagcatctatgatgtcaat
gatgcctacaaggaaatgagcgagtacaaaaatgcaggaagaattattattaataagttt
agctaa

DBGET integrated database retrieval system