KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_2681Help
Entry
YN1551_2681       CDS       T00902                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin00010  Glycolysis / Gluconeogenesis
sin00020  Citrate cycle (TCA cycle)
sin00620  Pyruvate metabolism
sin00640  Propanoate metabolism
sin00650  Butanoate metabolism
sin00680  Methane metabolism
sin00720  Carbon fixation pathways in prokaryotes
sin01100  Metabolic pathways
sin01120  Microbial metabolism in diverse environments
sin01130  Biosynthesis of antibiotics
sin01200  Carbon metabolism
Module
sin_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YN1551_2681
   00020 Citrate cycle (TCA cycle)
    YN1551_2681
   00620 Pyruvate metabolism
    YN1551_2681
   00640 Propanoate metabolism
    YN1551_2681
   00650 Butanoate metabolism
    YN1551_2681
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YN1551_2681
   00680 Methane metabolism
    YN1551_2681
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YN1551_2681
Enzymes [BR:sin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     YN1551_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ACP49595
JGI: SislY22681
UniProt: C3NLP2
Position
2378979..2380136
Genome map
AA seq 385 aa AA seqDB search
MQVLKRKTLALVGNHAVAYAVKQSKPQVLAVFPITPQTTMLEKISEYIASEELNAELIKV
ESEHSALASIYGAALAGARVFTATSSQGLLYMTEMIYWAGGQRVPMVAAVATRAIAEPWS
IWDDHQDFLSKRDAIWIQMMAENVQEAYDMTIQAFRISEDERVILPVMMGFDGFILTHTM
ERIEVLEDGEVDNFLPPRQFNLIDFSDPIGVGPIATPEDYIKYRYEAMKAMERAKGVIEE
VMNEYERISGRKQNGLVECYKCEDAKYVFVTMGAWSGDCKVAVDRLRDAGVEAGLLKIRV
FRPFPKEKIEEYLRSMKGVIVLDRAYSYGSGGILANEIKATLYGYRVPVYSVIAGIGGKD
VRPRHFQKVIEDLINDNLEEERWLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttttaaagaggaaaactttagctttagttggtaatcacgcagttgcttatgct
gttaagcaatctaaacctcaagttttagcggtgttcccaataactcctcaaactacaatg
ctagagaaaatttccgaatacatagcttctgaggaattaaatgctgagttaataaaggtg
gaaagtgagcattctgcgttggcttcaatttatggtgctgcattggctggtgctagagtt
ttcactgcaacgtcttctcaaggactactatacatgactgagatgatatattgggctgga
ggtcaaagagtccctatggttgctgcagttgcaactagggcaattgcagagccttggagt
atttgggatgatcatcaagatttcctaagtaagagagatgcaatttggattcaaatgatg
gcagaaaacgttcaagaggcttacgatatgacaatacaagcgtttagaatttcagaagat
gagagagtaatcttaccagtcatgatgggatttgatggcttcatattaactcacacaatg
gaaaggattgaggtattagaggatggtgaggttgacaactttttaccgcctagacaattt
aacctaattgacttctctgatcctattggtgttggaccaatcgcaactccagaggattac
atcaagtataggtatgaggctatgaaggccatggaaagagctaaaggggttattgaggaa
gtaatgaatgaatacgagaggataagtggaaggaaacaaaacggtttagttgagtgttat
aaatgtgaagatgccaaatacgttttcgttaccatgggagcgtggagtggtgactgtaag
gttgctgtggatagactaagggatgctggggttgaggctggattgctcaaaatcagggta
tttagaccattcccaaaggagaaaatagaggaatacttaaggtcaatgaaaggtgtaata
gttctcgatagagcttattcgtatggttctggggggattttagcaaatgagataaaagct
acactttatggctatagagtaccagtttacagcgtaatagcaggtattggtggaaaggac
gttaggccacgtcacttccaaaaggtgattgaagacctaatcaacgataatttggaagag
gagaggtggttgttgtga

DBGET integrated database retrieval system