KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_2995Help
Entry
YN1551_2995       CDS       T00902                                 

Definition
type II secretion system protein E
Orthology
K07332  
archaeal flagellar protein FlaI
Organism
sin  Sulfolobus islandicus Y.N.15.51
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2647790..2649382
Genome map
AA seq 530 aa AA seqDB search
MTTIKYFIFIFLNRYMVLIGKKKSHNKFEELSYYLQSIDESGIISLRASLENHNIVEHYS
LKNFDVEVYIVEKEGIGYYLVNEPQLDQREEKILLAILDGLIYSPTTVVSNKQIDVEKLQ
EDVLKISAKLGVVGDVKRNLKKYMYYITREIKYSVLQVPMSDPFIEEIELVSPTTPISVV
HSRHSEWPRLETNIILGSELKVRRIVERLASLGGRSVSTATPLQDFMLHEGHRVAVSYGE
EISRGTTFNIRKFPEKPLTIIDLVYKYGTLSELMAVYLWIIAEAKLFTFLVGPSGSGKTT
ALNSLLMLLNPLAKYLTIEDTPELKLPHKYWIQFYTRPSNYEGSKDISYYELVRLSLRYR
PDYIIVGEVRGKEIEWLVQAVASGHGGLTTFHGSNHVDLITRISGLLGQDLSLQFKQLIS
VIAIIKRIETENRKMNRKIISIVENDGNGFREVFKYDYERKSFLPNNSKEIGSIQLEKAR
ELLGWSKDKLYKEIENRLLLIRGLAERGVYDYDALAKELVKYYINGDRGG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgactacaataaagtattttatttttatttttttaaataggtatatggtacttattggt
aaaaagaaatcacataataaatttgaagaattatcctattatctacaatcgattgatgaa
tcgggaataatatctcttagagctagcttggaaaatcacaatatcgtagagcactattct
ctaaaaaactttgacgttgaagtttacattgtcgaaaaagaggggattggttactattta
gtaaacgaacctcagcttgatcagagagaagaaaagatcttattagcgattcttgacggt
ttaatatattctcccacaactgtggtttctaataaacaaattgacgtggaaaaactacaa
gaagatgtattgaaaatttcagctaaattaggagtagtaggtgacgtaaagagaaactta
aagaaatatatgtactatataactcgagagataaaatattcagtcctacaagtaccaatg
agtgacccttttatcgaagagatagaactagtatccccaacgacaccaatttcagtagtc
catagcagacatagtgaatggcctagattggagactaatatcattttagggagtgagttg
aaggttaggagaatagtagagaggttagcatctttaggtgggagaagcgtaagtacagct
acaccattacaagattttatgttacacgaaggtcatagagttgcagtgagttacggtgag
gaaataagtagaggaacgacatttaatataagaaaattcccagaaaagcctctaacgatt
attgacttggtttacaagtatggtacattaagcgagctaatggcagtttacttatggata
attgccgaggctaagctatttacatttctcgtaggcccaagtggtagcggaaagaccact
gcattaaactcactattaatgctacttaatccattagcgaaatatttaacgattgaggat
acaccggagctaaaattacctcacaaatattggatacaattctatactagaccttcaaac
tatgaagggagtaaggatatcagttattatgaactagtcagactctccttaagatataga
ccagattacattatagtaggggaagtaagagggaaagaaatagaatggctagttcaagct
gttgccagtggtcatggtgggctcacaacatttcatgggtctaatcacgttgacttaata
actagaattagtgggttattgggtcaagatctatcgttacaatttaaacagctaatttca
gtgattgcaatcataaagagaattgaaaccgagaatagaaagatgaataggaaaataata
tctattgttgaaaatgatggaaacggatttagggaagtatttaaatatgattatgaaagg
aagagcttccttcccaataattcaaaagaaattggtagcatacagctggaaaaagctaga
gaattattaggctggagtaaggataagttgtataaggagatagaaaatagactattatta
ataagggggcttgctgaaaggggagtttacgactacgacgcattggcaaaagagttagtt
aaatattatataaatggtgataggggtggctga

DBGET integrated database retrieval system