KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_3077Help
Entry
YN1551_3077       CDS       T00902                                 

Definition
Protein-L-isoaspartate (D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2727209..2727919)
Genome map
AA seq 236 aa AA seqDB search
MGAKEDLLRSIKNSKLANAFIKVNREDFLPQLLKKYAYEPNYIDKPFYVTPNITTTALSL
GIYILDILNLEENQKVLEIGTGIGYYTALIAEVVGENNIVSIEIDDTMFEYAKNVLLIRY
PLIKLLKTDGSLGYEKEAPYDRIVVWAAAPTIPCKLYDQLKENGIMVVPIGGEKAQGLYR
ITKTGYEPKIERIGDVIFMKMRGLFGFYDNDDPNERRIKKLEEKVNRLLSKFMNQN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaaaagaagacttattaagatctataaaaaattcaaagttggctaatgcattt
atcaaagttaatagagaagactttttgccgcaactattgaaaaaatacgcatatgagcca
aattatatagataaacccttttatgtaacacctaacattacgacaacggcgctaagttta
ggcatatatattcttgatattcttaatttagaagaaaatcagaaggttttagagataggt
actggtataggttattacacagcactgatagctgaagtagttggtgagaataacattgta
tctatcgagatcgatgatacgatgtttgagtacgctaaaaatgttcttctgatcagatac
cccctaattaaattactgaagacggatggaagtttaggatatgagaaagaggccccttat
gatcggatcgtagtatgggcagctgcaccaactataccttgtaagctatacgatcaactt
aaggaaaacgggatcatggtagtaccaataggaggtgaaaaagcccaaggtctttataga
attactaaaactggttatgagcctaagatagaaagaattggggatgtgatatttatgaaa
atgagaggattatttggattttatgataatgacgatccaaacgagaggagaataaaaaaa
ttagaggaaaaggtaaataggttgctgtcaaaattcatgaatcaaaattag

DBGET integrated database retrieval system