KEGG   Sesamum indicum (sesame): 105155876Help
Entry
105155876         CDS       T04135                                 

Definition
(RefSeq) acid beta-fructofuranosidase 2, vacuolar-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sind  Sesamum indicum (sesame)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    105155876
   00500 Starch and sucrose metabolism
    105155876
Enzymes [BR:sind01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105155876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
LG1
AA seq 655 aa AA seqDB search
MQKMAFPGRHALHEPSHSHIPSSYAPLLDPATTSAFEAPDRQCRRRRSSVVALPLMAVLL
VVALFSVVALVTNGNKPNPMVSTPPESQQPENMIPSRRGETEGVSLKSFRPLLGAPKYSW
TKKLLAWQKTGFHFQPKKNWMNDPNGPVFYKGWYHFFYQYNPYGAVWGNIAWGHAVSRDL
IHWRHLPMAMVPDDWYDINGVWTGSATILEDGRLVMLYTGSTNESVQVQNLAYPADPLDP
LLVDWVKYPGNPVLVPPPGIGSKDFRDPTTAWLTPQGKWRFIIGSKLNKTGISLVYDTKD
FKTYELLNGLLHSVPGTGMWECVDIFPVSKIVENGLDTGENGPGVKHVVKTSLDDDRNDY
YALGTYDGETGKWIPDDPINDVGIGLRYDYGIFYASKTFYDQEKKRRVLWGWIKETDSEN
ADIQKGWASVQAIPRTILFDKKTGTNILQWPVEEVERLRMSKKVFDKVEAKPGSIVPLHV
GFATSQLDIVAEFEVDKVALESINDTDHTTYSCPTSHGAAQRGALGPFGLLVHTDNHQTE
QTPVYFYISKDTEGNFKTFFCADHSRSSEAIDVDKAIYGSTVPVLEGEKLSMRILVDHSI
IESFAQGGRTCITSRIYPMRAVYENAGIFLFNNATDATITASLHIWQMSSAYAHS
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatggcttttccaggtcgccatgcattgcacgagccatcccacagtcacatc
ccatcttcctacgctccattgctcgaccccgccaccacctccgcctttgaagctcccgat
aggcaatgccggcgccgccgctcctccgtcgtggccctccccctgatggcagtccttttg
gtcgtcgccctgttctcggtggtggctttggtcacaaatggcaacaaacctaatccaatg
gtctccacaccgccggagtcacagcagccggagaacatgataccgtcccgacgtggcgag
acggagggagtgtcgttgaaatcgttccgtccgctgctcggagctcctaagtactcatgg
accaagaaattgttggcttggcagaaaactggattccatttccagcccaaaaagaattgg
atgaacgatcctaatggtccagtattttacaagggatggtaccactttttctaccaatac
aatccatatggtgcagtatggggcaacattgcttggggacatgcagtttcaagagacctc
atccactggcgccacctccccatggccatggttcccgatgattggtacgatatcaacggt
gtctggactggttccgccaccatccttgaggatggtcgacttgtcatgctctacacagga
tccaccaatgagtccgtgcaggttcaaaatcttgcataccctgccgacccattggatcct
ctccttgttgattgggtcaagtaccctggtaacccggtattggtcccaccaccaggcatc
gggtctaaagactttcgtgatcccaccacggcttggttgactccacaaggcaagtggcgc
ttcatcattggctccaaacttaacaagactggcatttcattggtgtacgacaccaaggac
tttaaaacttacgagcttcttaatggattgctgcatagtgtcccgggcacgggcatgtgg
gagtgtgtcgatatcttccccgtttccaagattgtggaaaatgggttggacacgggagaa
aacgggcctggagtgaaacatgtcgtcaagactagtcttgatgatgacagaaatgactat
tatgctctcggaacttatgatggtgagacaggaaaatggatccctgatgatccaataaat
gatgttggtatcggattgagatatgattatggtattttctatgcatcaaagacattctat
gatcaagaaaagaagaggagagtcttgtggggatggatcaaggagaccgacagtgaaaat
gctgatatacaaaagggttgggcatcagttcaggctattccaagaacaatattgttcgac
aagaaaaccggtacgaatatcctgcaatggccggtagaggaggtggagagattgagaatg
agcaagaaggttttcgacaaagtggaggctaaacctggctcaattgtgccccttcatgtc
ggctttgcgacttctcagcttgatattgtggctgagtttgaagtagataaagtggcattg
gagagcataaatgatacagatcacacgacctatagttgcccgactagccatggtgctgct
cagagaggggcgttgggacctttcggtctattggttcacacagataaccaccaaaccgag
cagaccccagtttacttctacatttccaaggacacagaaggaaatttcaagacattcttc
tgtgctgatcactcaaggtcatctgaagcaattgatgtcgacaaagcgatctacggtagc
acagtgccagtactagaaggcgaaaaactatccatgagaatactagtggatcactcgatc
atcgagagctttgctcagggcgggaggacgtgcataacgtcgcgtatatatccgatgaga
gcagtctatgaaaatgcaggaattttcttgttcaacaatgctactgatgcaaccatcact
gcctcgctgcacatatggcaaatgagttctgcctatgcacactcgtaa

DBGET integrated database retrieval system