KEGG   Streptococcus sp. I-P16: N597_02740Help
Entry
N597_02740        CDS       T02880                                 

Definition
glycogen-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sip  Streptococcus sp. I-P16
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sip00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N597_02740
Enzymes [BR:sip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     N597_02740
Exosome [BR:sip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N597_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
517477..519378
Genome map
AA seq 633 aa AA seqDB search
MDTKQALYTFGTGENFHLQHYLGAHKEQVDGVEGYCFRVWAPNAQAVHLVGDFTQWEENE
IPMVRNEAGVWEVFTTAPQVGDIYKYHVTRQNGHRLMKVDPLAVRMEKRPGTGAVITDIP
ERKWKDGLWMARRRKLGFRSRPVNIYEVHAGSWKRNEDGSPYSFAQLKEDLIPYLVKMNY
THVEFMPVMAHPLGLSWGYQLMGYFALEHTYGTPEEFQDFVEACHLNNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHHRAHNYGWGAMNFDLGKNQVQSFLISSVKFWIEFYHLDG
IRVDAVSNMLYLDYDSGPWTPNIDGGNLNYEGIHFLKRMNAVIKLEHPDVIMVAEESSSG
TKITGPEEYGGLGFDYKWNMGWMNDILRFYEEDPIYRKFDFNLVTFSFMYAFSENFLLPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLLTYQICHPGKKLLFMGSEFGQFLEWRSEEQ
LEWSNLEDDMNRKMQEFTSQLNQFYKDNKMLWEIDDSYDGIEIIDADNRDQSVLTFTRKD
KKGNHLLCIFNMAPVERKDFTVGVPVAGVYEEIWNTELEKWGGVWKEHNQEVKTQEGLWK
DYPQTLTFTLPALGASVWKVKRKLRSNVSKTKE
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggatacgaaacaagcattgtacacatttggaaccggagagaactttcatcttcaacat
tatctaggggctcataaagagcaagtagatggtgtggaggggtattgtttccgcgtatgg
gctccaaatgcacaggcagtacacttagtaggtgatttcacccaatgggaagaaaatgaa
attcctatggtgagaaatgaagctggtgtttgggaagtttttacaacagcacctcaagtg
ggagatatttataagtaccatgttacaagacaaaatggccaccgcttgatgaaggtggat
cctttagcggtacgcatggaaaaacgtccaggtacaggagcggttattactgatattcca
gagcggaaatggaaagatggactgtggatggcgagacggagaaaacttggttttcgatct
cgaccagttaatatctatgaggttcatgctggatcctggaaacggaatgaagatggaagt
ccttattcctttgctcagttgaaggaagatttgattccttacttggtgaaaatgaactat
acccatgtggagttcatgccggtgatggctcacccgctcggactaagttggggctatcaa
ttgatgggttactttgccttggaacatacttacggaacaccggaagagtttcaggatttc
gttgaggcctgtcacttgaataacattggggtgattgtggactgggtgcccggacacttt
acgatcaatgatgatgccttggcctattatgatgggacaccaacctttgaatatcaggac
catcatcgggctcacaactatggttggggagcaatgaactttgacctagggaaaaaccag
gtccaatccttccttatttctagtgtaaaattctggattgagttttatcatttggatgga
atccgggtcgatgcggtcagcaacatgctctacttagattacgatagtggtccatggaca
ccaaatatcgatggtggaaatctcaattatgaggggattcatttccttaaacgaatgaat
gcggtgattaaacttgagcatcctgatgtgatcatggttgctgaagaaagttcatctgga
actaagattactggtccagaagaatacggtggcttaggttttgactacaagtggaatatg
ggatggatgaatgatatccttcgcttctacgaggaagatcctatttaccggaaatttgat
ttcaatttggtgacctttagctttatgtatgctttctctgagaatttcttgttgccgttt
tctcacgatgaagtggtgcatggcaagaagagtctcatgcataagatgtggggagatcgc
tacaatcagttcgccggcttgagaaatctcttgacctatcagatttgtcacccagggaag
aaattgctcttcatgggttcagagtttggccaattcttagagtggaggtctgaagaacag
ttagaatggtctaatctggaagatgacatgaaccgcaagatgcaagaatttacttcccag
ctcaatcaattctacaaagacaacaagatgttgtgggaaattgatgatagctatgatggt
attgagattattgatgcagataaccgagatcaaagcgttttgacctttactcgtaaggat
aaaaaaggaaatcatttgctttgtatctttaatatggcaccagtagagcgcaaggacttt
acagtcggcgtccctgtagctggggtctatgaagaaatttggaatacagaattagagaaa
tggggaggtgtctggaaagagcacaaccaagaagtgaagactcaagagggattatggaaa
gattatccacaaaccttaacctttactttaccggctcttggagctagtgtatggaaagtg
aaacgaaaacttcgttccaatgtgtctaaaacaaaagaatag

DBGET integrated database retrieval system