KEGG   Streptococcus sp. I-P16: N597_08610Help
Entry
N597_08610        CDS       T02880                                 

Definition
(GenBank) penicillin-binding protein 2A
  KO
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 3.4.16.4]
Organism
sip  Streptococcus sp. I-P16
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sip00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N597_08610
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    N597_08610
Enzymes [BR:sip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     N597_08610
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N597_08610
Glycosyltransferases [BR:sip01003]
 Polysaccharide
  Bacterial polysaccharide
   N597_08610
Peptidoglycan biosynthesis and degradation proteins [BR:sip01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   N597_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1757346..1759577)
Genome map
AA seq 743 aa AA seqDB search
MNKLKELMEGMIRHFQREKKPRKIAEEVELSTDGEEQAPTYSRSENSRRKSHSQHPIRRF
WRKYHLTKIFLLIGLTFSLVVGGYLFYIAKTTNVADLQNALKATTIIYDKDGNQAGSLTG
QKGTYVELDAISENLQNAVVATEDRSFYKNSGINYGRFFLAILTAGRSGGGSTITQQLAK
NAYLSQDQTVERKAKEFFLALEINKKYSKQEILTMYLNNAYFGNGVWGIEDASKKYFGVS
ASELTLDQSAVLAGMLKGPEIYNPLYSVENATNRRNTVLQNMVAAGYIDQATADQSAAVD
IHGQLVDAYEGKSEDYRYPSYFDAVINEAVNEYGLTEEDIIKNGYRIYTEMDQNYQASMQ
VIYDNVDLFPVAEDGTRAESGSVALDPKTGGVRAIVGRVASDQDAGFRSYNYATQSARSP
GSTIKPLVVYSPAVANGWSTNKELDNTTRVYGSYTVDNYGGIQGSPTVPMYQALAESLNL
PAVATANELGLNTVFDYGKKFGLDMDKVDRSLGVALGSGVTTNPLQMAQAYGTFANDGVM
NDAHLITKIENASGQVVKSHSQKSKRVLSSSANKKMTNMMLGTFTNGTGVNAAPYGYTMA
GKTGTTETDFNPDLSGDQWVIGYTPDVVISQWLGFPKTDETHYLTGTSAETASVIFRNVA
NSVLPYTEGTGFDNEENSYQENGIAPVGQETETESPEEDKGFFDTVKERAAGIVDDAKKA
IDEADIPGKAQNAWDTFKGWFGF
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattaaaagaattaatggagggaatgattcgtcatttccaacgagagaaaaaa
ccaaggaagattgcggaagaggttgagttatcaacggacggggaggagcaagctccaacc
tatagccggtcggagaattcacggagaaaatctcactcccaacatccgatcagacgcttt
tggcgcaagtatcacttgaccaagatcttcttattgattggcctgacctttagtctcgtc
gtcggaggttaccttttctacatagccaagacgaccaatgtagcggatctgcaaaacgcc
ctcaaggcgaccacgatcatctatgataaagatgggaaccaagcaggtagcctaacgggg
caaaaagggacctatgttgagttagatgcgattagcgaaaacttacaaaatgcggttgtt
gcgacggaagaccgaagtttctacaaaaatagtgggattaactacggtcgtttcttcctg
gcgattttgactgccggtcgctcaggtgggggatcgacgatcacccagcagttggccaaa
aatgcctatctttctcaggatcagacggttgagcggaaggccaaggagttcttcctggcc
ctcgagattaacaaaaaatatagtaagcaagaaatcctgaccatgtacctcaacaatgcc
tattttggaaatggggtttgggggattgaagacgcttctaagaaatattttggggtctcc
gctagtgagttgactttggatcagtcggctgtccttgccggtatgctcaaggggccagaa
atttataatcccctttattccgtcgagaacgccaccaatcgtcgcaatacggtcctacaa
aatatggttgcggctggttatattgaccaagccacagcagatcaatccgctgcagtcgac
attcatggacagctggtggatgcctatgaaggcaagtcagaagattatcgctacccgtcc
tatttcgatgcggttatcaacgaggctgtcaacgaatatggtctaacagaagaagatatc
atcaagaatggttaccggatctacacagagatggaccagaattaccaagccagcatgcag
gttatctacgacaatgtagatctcttcccagttgctgaagatggcacgcgggcagaatct
ggtagcgtagctctggatcctaagactggaggagtgcgggcgattgtcggacgcgtggcc
agtgaccaagatgctggcttcagaagctataactatgcgactcaatctgcgagaagtcct
ggttctaccattaagcctctcgtcgtttatagtccagctgttgccaacggctggtcgacc
aacaaagaattggacaatacgaccagggtctacggcagttatacagtcgataactacggt
ggcattcaaggtagcccgaccgttccaatgtaccaagccttggcagaatctctcaacctt
ccagctgtagcgacagccaatgagttggggctcaatactgtctttgattacgggaaaaaa
tttggtctcgatatggacaaggtggacaggtccctcggagtagccctcggatctggtgtg
acgaccaatccgcttcagatggctcaggcctatggaacctttgccaacgacggagtgatg
aatgatgctcatctcattacgaagattgaaaatgctagcggtcaggtcgtgaaaagtcac
agtcagaaatcgaaacgagtgctcagcagctcagccaataagaagatgaccaatatgatg
ttgggaacctttaccaacgggacgggtgtcaacgcagcaccatatggctataccatggct
ggtaaaacaggaacgactgaaacggacttcaaccctgatctttccggagaccagtgggtc
attggctacacgccagacgtggtcattagtcagtggctaggattccctaagacggatgaa
acccactatttgacaggaaccagtgcagagaccgcatcagtgattttccgaaatgtcgcc
aatagcgtcctgccttatacagaaggaaccggctttgataatgaggaaaattcttaccag
gaaaatggaattgctcctgtcggtcaagaaacagaaacggaaagtccagaagaggacaag
ggcttctttgatacggtcaaagaacgcgctgcaggtatcgtagacgatgccaaaaaagca
atcgatgaagcagatattcctggaaaagcgcaaaatgcctgggatactttcaaaggttgg
tttggattctaa

DBGET integrated database retrieval system