KEGG   Sulfolobus islandicus REY15A: SiRe_0033Help
Entry
SiRe_0033         CDS       T01953                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sir01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sir00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sir00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sir00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sir00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sir00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(29556..31268)
Genome map
AA seq 570 aa AA seqDB search
MDYYTLYDLSLEKPETYWETFANKLSFFKKWEKVIEKNKQLPIAKWFVNGTTNIAYNALN
HTGKALIFYKEHKYKGDEITFNELNNMSSMIAGLLLDKGVRRGDRIAIYMPNSIYTIATI
LAAARIGVIYTLVFAGLGINAIVSRISNLEPKLVISTDKTFRRGKEIKLYTNLANIIFPR
DSQFDYPREYKEFEKIESNEPLKIMYTSGTTGKPKGIILPHGAWMVGDYTVFELMFSLKS
NDIVLTTADVGWITFSRIMYGTLMHGSTLAFIEGAPDYPTDRLPKIIDELQPKVLFTSPT
LLRTLQKLDVKLPRVEFIATAGEIMDETAWKYALRFSDKVVDVYGQTELGYVIGYPYALD
SVEPKIGYAGLPFPGAVIDTVDEYGKSLRGHVGHLIARGPFPTQFIGIWKDEAKFLSYFE
KFNGHDTGDLAIINEKGYVKIVGRDDDMIKIAGHRITSGEVESVINSLEGIVESAAVGIP
DEIKGEKLVVFYVGNIDEKTIVTKVREMLGPIYVIDKIYKVERLPKSRSGKIVRRVLRDL
LLEKEIDETILEDPEILKEIKSEIKRSERI
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggactactacacactttacgacctttccttagaaaaaccagaaacttactgggaaacc
tttgccaataaactatcattctttaagaaatgggaaaaagtcatagaaaaaaataaacaa
ctacccatagctaaatggttcgttaacggtactacaaatattgcatataacgctcttaat
cacactggtaaggcccttatattttataaagagcataaatacaaaggagatgaaatcacc
ttcaatgagttaaacaatatgagctcaatgattgctggattattattagataaaggggta
agaagaggagataggattgcaatttacatgcctaactcaatatatacgatagctacaata
ttagctgcagctagaataggagtaatttatacactcgtttttgcaggattaggaataaat
gctatagtaagtagaatttcaaatctagaacctaaattagtaatctccacagataagaca
ttcagaaggggaaaggaaataaaattgtatactaacttagccaacataatatttccaagg
gattcacaatttgactatccaagagaatataaagaatttgagaaaatagaaagtaatgaa
ccattaaagataatgtacacttccggaacaactggaaaacctaaaggtataatcttacca
catggagcttggatggtaggggattacacagtatttgagttaatgttctcattaaaaagc
aatgatatagttctaacaactgcggatgttggatggataacgttctcgagaataatgtat
ggaactctaatgcatggttccacattagcatttatagagggagcaccagactatccaaca
gatagattaccgaaaataattgacgagttacagcctaaagtactatttacatccccaaca
cttcttagaactttgcagaaattggatgtaaaactgccaagagtggagttcatagccact
gctggggagataatggatgaaacagcatggaaatacgcattaagattctctgataaagtt
gtagatgtatatggacaaactgaattgggttacgtaataggttatccatatgcgttagat
agtgtggaaccaaaaatagggtatgcaggattaccattccctggtgcagttatagataca
gtggacgaatatgggaaaagtttaagaggacatgttggccacctaatagcaagaggacca
ttccctactcaatttattgggatttggaaagacgaagccaaatttttaagctattttgaa
aaattcaacggccatgatactggggatctagctataattaacgaaaagggttatgtgaaa
atagttggtagagatgatgatatgataaagatagctgggcatagaataactagtggagaa
gtagaaagtgtaataaattctttggaaggaatagttgaatcagctgctgtaggaatacca
gatgagataaagggtgaaaaattagtagttttttacgtgggaaacatagacgaaaaaaca
atagtaactaaagtaagggagatgttaggtcccatatacgttattgacaaaatatacaag
gttgaaagactacccaagtctcgaagcggtaaaatagttaggagagttttgagggattta
ctattggaaaaagaaatagatgaaactatattggaagacccagaaatattaaaggagatc
aaaagtgagattaagagatccgagagaatttag

DBGET integrated database retrieval system