KEGG   Sulfolobus islandicus REY15A: SiRe_0366Help
Entry
SiRe_0366         CDS       T01953                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SiRe_0366
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_0366
   00020 Citrate cycle (TCA cycle)
    SiRe_0366
   00620 Pyruvate metabolism
    SiRe_0366
   00640 Propanoate metabolism
    SiRe_0366
   00650 Butanoate metabolism
    SiRe_0366
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiRe_0366
   00680 Methane metabolism
    SiRe_0366
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SiRe_0366
Enzymes [BR:sir01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SiRe_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(329935..330483)
Genome map
AA seq 182 aa AA seqDB search
MTLIELALRGRGGQGIVTAGELVTKAMVLEDKYAQSIPFFGGERRGAPVVSFLRLSDKPI
LLHREVYNPDGVAIFDTSLIQIINVTEGLKENGFLLLNTNTPKRIWKSEYIVDATSIAKE
LGLVVAGWAVVNTAMIGALVKILGQPSLHSLEETVKEEFPGKIGELNAEAVEMGYKGVKR
VD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgactcttattgaattagctttaaggggaaggggagggcaaggaatagttactgctggg
gaacttgttacaaaggccatggttttagaggataaatacgcccaatccataccctttttc
ggtggggaaaggagaggagctccagtcgtatcatttctaaggctgtcagataagccgata
cttttacatagagaagtttacaatccagacggtgttgcaatatttgatacgtcactcatt
caaataattaacgttacagagggactcaaagaaaacggtttcttactactaaacacaaat
acgcctaagagaatttggaaaagtgagtatattgttgacgctacaagtattgctaaagaa
ttagggctagtcgtagctggatgggctgttgttaataccgcgatgataggagctttagtg
aaaatcttggggcaaccttccttacactcgttggaagagactgtaaaggaagaattcccg
ggaaagataggggaactcaatgcggaagcggttgaaatgggatataagggggtgaaaagg
gttgattaa

DBGET integrated database retrieval system