KEGG   Sulfolobus islandicus REY15A: SiRe_0397Help
Entry
SiRe_0397         CDS       T01953                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00010  Glycolysis / Gluconeogenesis
sir00071  Fatty acid degradation
sir00350  Tyrosine metabolism
sir00625  Chloroalkane and chloroalkene degradation
sir00626  Naphthalene degradation
sir01100  Metabolic pathways
sir01110  Biosynthesis of secondary metabolites
sir01120  Microbial metabolism in diverse environments
sir01130  Biosynthesis of antibiotics
sir01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_0397
  Lipid metabolism
   00071 Fatty acid degradation
    SiRe_0397
  Amino acid metabolism
   00350 Tyrosine metabolism
    SiRe_0397
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SiRe_0397
   00626 Naphthalene degradation
    SiRe_0397
Enzymes [BR:sir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SiRe_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_31 Methyltransf_25 DapB_N Methyltransf_12 MTS TrkA_N Methyltransf_11 Methyltransf_32 Methyltransf_4 Urocanase
Motif
Other DBs
NCBI-ProteinID: ADX84488
UniProt: F0NGB6
Position
359339..360382
Genome map
AA seq 347 aa AA seqDB search
MRAVRLVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGV
KLPVTLGHEIAGKIEEMGDEVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGI
NFDGAYAEYVLIPHYKYMYKLRRLNAVEASPLTCSGITTYRAVRKASLDPTKTLVVVGAG
GGLGTMAVQIAKAVSGATIIGVDVREEAVETAKRAGADYVINASVQDPLAEIRRITEGKG
IDAVIDLNNSEKTLSVYPKALAKQGKYIMVGLFGADLHFHAPLITLSEIQFVGSLVGNQS
DFLGIMRLAEAGKVKPMITKSMKLEEANEAIDNLENFKAVGRQVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttagattagtagaaataggaaaacctctcgttttaaaagatatagatata
cctaaacctaagggagcacaagttttgataaaggtagaggctgcgggagtttgtcattct
gatgttcacatgagacaagggagatttgggaatttaagaatagtagaagatttgggtgtg
aaattgccggtaactttaggtcacgagatcgcaggaaaaatagaggaaatgggagatgaa
gttgttggatactctaagggtgatctagttgcagttaacccttggcagggagaaggaaat
tgctattattgtagaataggggaagagcatttgtgcgattctcctagatggttaggaatt
aactttgatggagcttacgcagaatatgtgttaatacctcattataaatatatgtacaag
ctgagaagacttaatgccgtagaagcatcacctttaacttgttctggaataactacatat
agggcagttagaaaagcatcattagacccaactaagacattagtagtagtaggggctggt
ggcggtttaggaacaatggcggtacagatagctaaagctgtcagtggtgcaacgataata
ggtgtagatgtgagagaggaggcagtagagactgctaagagagctggagccgattacgta
ataaatgcgtcagttcaagatcccttagcggaaataaggagaataaccgaaggtaaggga
atcgacgctgtaatagacctaaataactctgagaaaacgctttcagtttatccaaaagct
ttggcaaaacaaggtaagtacataatggtgggattattcggagcggatttgcattttcac
gcaccattaataactttgtcagaaatacaattcgtaggtagtttagttggaaaccaatca
gactttttggggataatgagattagcagaggctggtaaagttaaaccaatgataactaag
agcatgaaattagaagaggcaaatgaggcgattgataatctagagaattttaaagctgtc
ggaagacaagtacttataccataa

DBGET integrated database retrieval system