KEGG   Sulfolobus islandicus REY15A: SiRe_0397Help
Entry
SiRe_0397         CDS       T01953                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SiRe_0397
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_0397
  Lipid metabolism
   00071 Fatty acid degradation
    SiRe_0397
  Amino acid metabolism
   00350 Tyrosine metabolism
    SiRe_0397
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SiRe_0397
   00626 Naphthalene degradation
    SiRe_0397
Enzymes [BR:sir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SiRe_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359339..360382
Genome map
AA seq 347 aa AA seqDB search
MRAVRLVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGV
KLPVTLGHEIAGKIEEMGDEVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGI
NFDGAYAEYVLIPHYKYMYKLRRLNAVEASPLTCSGITTYRAVRKASLDPTKTLVVVGAG
GGLGTMAVQIAKAVSGATIIGVDVREEAVETAKRAGADYVINASVQDPLAEIRRITEGKG
IDAVIDLNNSEKTLSVYPKALAKQGKYIMVGLFGADLHFHAPLITLSEIQFVGSLVGNQS
DFLGIMRLAEAGKVKPMITKSMKLEEANEAIDNLENFKAVGRQVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttagattagtagaaataggaaaacctctcgttttaaaagatatagatata
cctaaacctaagggagcacaagttttgataaaggtagaggctgcgggagtttgtcattct
gatgttcacatgagacaagggagatttgggaatttaagaatagtagaagatttgggtgtg
aaattgccggtaactttaggtcacgagatcgcaggaaaaatagaggaaatgggagatgaa
gttgttggatactctaagggtgatctagttgcagttaacccttggcagggagaaggaaat
tgctattattgtagaataggggaagagcatttgtgcgattctcctagatggttaggaatt
aactttgatggagcttacgcagaatatgtgttaatacctcattataaatatatgtacaag
ctgagaagacttaatgccgtagaagcatcacctttaacttgttctggaataactacatat
agggcagttagaaaagcatcattagacccaactaagacattagtagtagtaggggctggt
ggcggtttaggaacaatggcggtacagatagctaaagctgtcagtggtgcaacgataata
ggtgtagatgtgagagaggaggcagtagagactgctaagagagctggagccgattacgta
ataaatgcgtcagttcaagatcccttagcggaaataaggagaataaccgaaggtaaggga
atcgacgctgtaatagacctaaataactctgagaaaacgctttcagtttatccaaaagct
ttggcaaaacaaggtaagtacataatggtgggattattcggagcggatttgcattttcac
gcaccattaataactttgtcagaaatacaattcgtaggtagtttagttggaaaccaatca
gactttttggggataatgagattagcagaggctggtaaagttaaaccaatgataactaag
agcatgaaattagaagaggcaaatgaggcgattgataatctagagaattttaaagctgtc
ggaagacaagtacttataccataa

DBGET integrated database retrieval system