KEGG   Sulfolobus islandicus REY15A: SiRe_0568Help
Entry
SiRe_0568         CDS       T01953                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SiRe_0568
  Amino acid metabolism
   00300 Lysine biosynthesis
    SiRe_0568
Enzymes [BR:sir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SiRe_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(542381..543592)
Genome map
AA seq 403 aa AA seqDB search
MILDEIVEASKDEIVEFLKQLIRIPTENPPGLNYDKIISVLRDKLEEFGYKTEIIEGNKE
FVRFGNGNRPNLVGYLGNGNVRIAFNGHYDVVPAGEGWSINPYEGIEKDGKVYGRGASDM
KSGIVAQIYAVEMLKRAKLLPSNVKIIQTIVPDEETVGNKNAGTYCLREIYKKNADYVIF
TEPTGPDNICNGHRGAIWAVVKIYGKKSHGGFPQLGIDAVKAVAIMIERLYSSLSNITSK
YNIVPEAGKKPSILVGTVKCGTWVNTVADYCEFSIVRRLIPEERIDEVRESILRLLRDVS
SETGVKFDYDEFYAVDTVVSEDGRLIDALRKAIREVRGVDPNVVLSAGTFDIRFTVSEGI
KSINYGPGRIELAHSTDEFVYVKDLLDSIKALGRVLLEVAKGS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgagatcgttgaagcctctaaggatgaaattgtggagttcttaaagcag
ttaataaggatcccaactgagaatcctcccggcttaaattacgataagataattagcgtg
ttgagggataaattagaagagtttgggtataaaacggaaattattgagggtaataaagag
tttgtcaggttcggaaatggcaatagaccaaatctagtaggttatttgggtaatggcaac
gtaaggattgcgtttaatggacattacgatgttgttcccgccggtgagggatggagtatt
aacccttatgaggggattgaaaaagatggcaaggtttacggaagaggagcttctgacatg
aagtctggaatagttgcacaaatttacgctgttgaaatgttgaagagagctaaactactc
ccctctaacgtgaaaatcatccagaccattgtcccagatgaggagactgtaggcaataaa
aatgctggtacttattgtttaagggaaatttacaagaagaacgccgattacgtaatattc
acagaacctactggaccagataacatttgcaatggtcataggggtgcaatctgggctgtg
gttaaaatatatgggaagaaaagtcatggaggttttcctcaattaggaattgacgcagtt
aaggctgtagcgattatgattgaaagactttactcgtctttatccaacattacctcaaag
tacaacattgtaccagaggctggtaagaaaccgtcaatattagttggtactgttaagtgt
ggtacgtgggttaacactgtagcagactactgtgagttcagtatagttaggagattaatc
ccagaggagaggattgatgaggttagggagagcattttacggttgttaagggatgtgagt
agtgagactggcgttaagtttgattacgatgagttttacgctgtcgatactgtagtaagt
gaggatgggagactaatagatgctctgagaaaggctataagggaggttaggggagttgat
cccaatgttgttttatctgcagggactttcgatattaggtttaccgtaagtgaggggata
aagagtattaattacggtccgggtaggattgagttagcacattctacagatgagttcgtt
tacgttaaagatttattggattcaataaaagcgttgggaagagtactattggaggtggct
aaaggaagttag

DBGET integrated database retrieval system