KEGG   Sulfolobus islandicus REY15A: SiRe_0711Help
Entry
SiRe_0711         CDS       T01953                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SiRe_0711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_0711
   00620 Pyruvate metabolism
    SiRe_0711
   00640 Propanoate metabolism
    SiRe_0711
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiRe_0711
   00680 Methane metabolism
    SiRe_0711
Enzymes [BR:sir01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SiRe_0711
Lipid biosynthesis proteins [BR:sir01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SiRe_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(680461..682329)
Genome map
AA seq 622 aa AA seqDB search
MSWKIYSLDQIKALAKFSMENPEAFWRDKANYITWFRQPEKILEGEPPYEKWFVGGTTNI
SYNAIDRHLPDKKDKVAFYWTNERLDSFRSISFQDLYQEVNKAAYVLSELGVKKGDTVSM
LMPNIPEAVYFSLATHRLGAILIIHYVGLSEETVAYRFNDCGSKVLIVASKTFRNGNEIR
IKDFVDKVLESHTTPIQKVLAVPRGYSDFNVNGKRDVVYDDVKPKGKVYVKPVEVEANEP
ATVYYTSGTTGRPKGLYHSNGGYVIALNWAFKAIFNPTENDVWWTVSELGWPVWPMANLY
TIPVMGIPGVLFEGYVGYKRDLFSRVIERYNVSLVWSSTTTLYTLKSLGEESVKSGDTSS
LRMILNTGEPLNVGAWMWLNQNLPQVKMADAYWMTEHLSPVGATPYGIGEIPFKAGSAGI
QFPGGTYFLIVDDEGKSLPPKQKGYIVLKPLNPALAKMWNDPNYEKIKEKYWSRFPGYFY
TGDYGYVDEDGYLFVLGRADDVIRAEGERIGTLEVESVIVTHPNVAEAAVIGQGGNIIAF
VVPRQGVEVGDALRNDIKNYCRNAGYIVDKVVFVKRLPKTKSGKIMRRLLKAILANENPG
DVSTLDDIRIMEELKEALKSLS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagttggaaaatatattctctagatcagattaaagcattggcgaaattctctatggaa
aatccagaagccttctggcgagataaggctaattacataacttggtttaggcaaccagag
aaaatacttgagggagaaccaccgtacgagaagtggttcgttggaggaaccacaaatata
tcctataacgctatagataggcatttaccagataagaaagataaggtggcattttattgg
accaatgaaagattagatagttttaggtcaatatccttccaagatttatatcaagaagtg
aacaaagctgcttatgtcttaagtgaattgggcgtgaaaaaaggcgatacggtatccatg
ctaatgcctaatataccagaagctgtatacttctccttagcaacacacagactgggggca
attctaataatacattatgtaggtttgagcgaggaaacagtggcatataggtttaatgat
tgcggttcaaaagtattgattgttgcttcaaagacgtttaggaatggaaatgagataaga
attaaggattttgtggataaagttttggaatctcatactacacctatacagaaagtcttg
gcagtgccgaggggatattcagattttaatgttaatgggaaaagggatgttgtgtatgat
gatgtgaaacctaaagggaaagtttacgttaaaccagtggaagttgaggctaacgagcca
gcgacagtttattacacgtctggaactacgggaagacctaagggattataccatagtaat
ggagggtatgtgatagcactcaattgggcttttaaggcaatatttaacccaacagagaat
gacgtttggtggactgtttcagaattaggttggccagtatggccaatggcaaatttatac
acgataccagtaatgggaatacctggtgtgctttttgagggatatgttggttataaaagg
gatctattctcgagagtaattgagagatataatgtaagcctagtttggagttctaccaca
actctttacactctcaagagtttaggagaggagtcagttaagagcggagatacatcaagc
ttaagaatgattcttaatacaggagaacctttaaacgttggagcgtggatgtggttaaat
cagaatcttcctcaagttaagatggcagatgcttactggatgacagagcatttatcgcca
gttggtgcaactccttacggaatcggcgaaattccctttaaggcaggttcagctggtata
caattcccaggaggaacatatttcttaattgttgacgatgagggaaaatcattacctcct
aagcaaaagggttatatagtgttaaaaccgcttaacccagccttagctaaaatgtggaat
gatcccaattacgagaagataaaggagaagtattggtctaggttcccaggatacttctac
actggagattacggttatgttgatgaggatggatatctgttcgtgctgggaagagctgat
gatgtaataagagctgaaggggagaggataggaacacttgaagttgaaagtgtaatagta
actcatcccaacgtggccgaagctgccgtaataggtcaaggcggtaacataatagcgttt
gtagtcccaagacaaggggttgaggttggtgacgcactcagaaatgacattaagaactat
tgtaggaacgctggttacatagttgataaagtagtgtttgtgaagagactgcctaaaacc
aaaagcgggaagataatgagaaggctactaaaggctatcctagctaacgagaatccaggt
gatgtatcaacattggacgatataaggataatggaggaacttaaggaagcgttgaagagc
ctaagctaa

DBGET integrated database retrieval system