KEGG   Sulfolobus islandicus REY15A: SiRe_0742Help
Entry
SiRe_0742         CDS       T01953                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00630  Glyoxylate and dicarboxylate metabolism
sir01100  Metabolic pathways
sir01110  Biosynthesis of secondary metabolites
sir01120  Microbial metabolism in diverse environments
sir01200  Carbon metabolism
Module
sir_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SiRe_0742
Enzymes [BR:sir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SiRe_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADX84823
UniProt: F0NGM5
Position
712658..713971
Genome map
AA seq 437 aa AA seqDB search
MNIRDKWSEEEKRLEYEWSEDPRWKGIKRNYKPSDVVKLRGSIRIEYSIAKLASHKLWNL
LNTEPYIATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVKRLNNALLRADQISWSEGKRDIDYLLPIVADAEAGFGGPIHAFELTKALIEAGAAGVH
FEDQLAAEKKCGHLGGKVLIPISAFIRVLNAARLASDVLGVPTILIARTDALNAKYLSND
VDETDNQFLTGKRTSEGYYEIRGGIEYAIARGLAYAPYADLLWFETSKPDLGEARQFAEA
IHTHYPGKLLAYNLSPSFNWKKFMDDSKISRFMNELGEMGYKFQFITLAGWHLINYHTFK
LARAYRNEGMPAYVRLQESEFQAQAEGYTAVSHQREVGTDYFDLVLTIASGGEASTTAME
GSTEAEQFVEAKQKVLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgagataaatggagtgaagaggaaaaaagacttgaatacgagtggtccgaa
gatccaaggtggaaaggaataaagagaaattataagccctcggatgtggtaaaattaagg
ggatctatcagaattgagtatagtatagctaaattagcctcacataaactttggaacttg
ctaaatactgagccctatatagcaacatttggggcattaacgggttcccaagcagttgaa
atggcaaaagcgggccttaaagcaatttacgtaagtggatggcaagtagctgctgataac
aatttatcaaatcaaacttatccagacttgagcttatatccatctaacagtgttccaaac
ttagtaaagaggttaaataacgctcttttaagggctgaccaaatatcttggagtgagggt
aaacgcgatatcgattacttactgcctattgttgcagatgctgaagctggtttcggtggt
ccaattcacgctttcgaactaacaaaagccttaatagaggcaggggctgcgggcgtacat
tttgaagatcaattagcagcggagaaaaaatgtggacatttaggaggaaaagttctaatt
ccaataagtgcatttataagagtactaaacgctgcaagactagcatctgacgtattagga
gtacccacaatactaatagcaaggacagacgcactaaatgcgaaatacttatctaacgat
gtagatgagactgataatcaatttttaactggaaaaagaacatcagagggatattatgag
attaggggaggtatcgaatacgctattgccagaggattagcttatgcaccctatgcggac
ctattatggtttgagacttctaagccagatttgggagaggctagacaatttgcagaggct
atccacactcattaccccggtaagttgttagcgtataacctatccccctcatttaactgg
aagaaatttatggatgattccaaaatcagtaggttcatgaacgaattaggagaaatgggc
tataaattccaattcataacccttgcaggttggcacttaattaactaccatacattcaaa
ttggcgagagcatatagaaacgaaggaatgccagcatatgtaagactacaggagtcagag
ttccaggctcaagcagaaggatatacggccgtaagtcatcagagagaggttggaacagat
tacttcgacctagtgttaacaatagcatctgggggagaagcgtccactactgcaatggaa
ggttctactgaagctgaacagtttgtagaggcaaaacagaaagtattgaaataa

DBGET integrated database retrieval system