KEGG   Sulfolobus islandicus REY15A: SiRe_1098Help
Entry
SiRe_1098         CDS       T01953                                 

Definition
Alpha-amylase
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SiRe_1098
Enzymes [BR:sir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SiRe_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056745..1058088
Genome map
AA seq 447 aa AA seqDB search
MKRIILGFEVHQPFRIRRDFFWNPRFRQSLEDRFFDTQRNKDIFERIKKNCYIPATNIIL
NSIERAEEEGKDVKYFFSISGTFLEQAERWGREVIDLFQQLAYTHKVEFLAQTYYHSVTG
LWEDKSEWREQVKMHRDAIKSYFGQYPTTFENTELITKRDIIEEAERMGFKMMLSEGTSR
NLRGRSPNYVYKLKGHEIRILFRNYILSDDIAFRFSNPNWDQYPLTASKYADWISKSEGN
VGLIFVDYETFGEHHKEHTGILEFLKWLPIELENKGVEMMMPKDVYNDVYDEIEISHTTS
WADIEKDEKSWLGNIMQWAYDDAVRRAEMPSRELGNEYLRVWRYFTTSDNYYYLYLGHGS
PAEVHSYFNAFGSPIDAFINEFYAISTFIHEEINKLNIKNEPYIFMLGDKRASIAWNEKE
FMEIIMRDERFKTHLKNLRQWLGNEKD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataatattaggatttgaagttcatcagccgttcaggattagaagagatttc
ttctggaacccgagatttaggcaaagcttagaggataggtttttcgatactcagagaaat
aaggatatatttgagagaataaagaagaactgctatatccctgcaactaatataatacta
aactccattgaaagagctgaagaggaaggtaaagacgttaaatacttcttttcaatttca
ggtactttcttagagcaagctgaaagatggggaagagaagtaatagacttgtttcaacaa
ttggcttacactcataaagttgaatttctagcacaaacatactatcactcagtaactggt
ctttgggaggataaaagtgaatggagagagcaagttaagatgcatagggatgctataaaa
tcgtattttgggcaatatcctactacttttgaaaacactgaattaataactaaaagggat
attatagaagaagctgaaaggatgggctttaagatgatgttaagcgaagggactagtagg
aatttaaggggaagaagtccaaattatgtctataaattaaagggacatgagattagaata
ttgtttagaaattacatattaagtgacgatatagccttcaggttttctaatccaaattgg
gatcaatatccgttaacggcttccaaatacgctgattggataagtaagagtgagggaaat
gtgggattaatattcgtagattacgagacttttggagaacatcacaaagagcatactgga
attttagaatttctcaaatggctaccaatagagcttgagaataaaggggtggaaatgatg
atgccaaaggacgtttacaatgatgtctatgatgaaatagagatctctcacactacctca
tgggcggatatagaaaaggatgagaaaagttggttaggtaatataatgcaatgggcttac
gacgacgcagttagaagggctgagatgccctcaagggaattggggaatgagtacttaaga
gtttggaggtatttcactacaagcgataattactattatctttatttagggcatgggagt
ccagctgaagtacattcctatttcaacgcctttggatctcctatagacgcatttataaat
gaattttatgcaatatcgacatttatacatgaggagataaataaattaaatattaagaat
gagccttatatatttatgttaggagataagagagcgtcaatagcttggaatgaaaaagaa
ttcatggaaattataatgagagatgaaaggtttaaaactcatttgaaaaacttaaggcag
tggttaggaaatgaaaaggattga

DBGET integrated database retrieval system