KEGG   Sulfolobus islandicus REY15A: SiRe_1521Help
Entry
SiRe_1521         CDS       T01953                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sir  Sulfolobus islandicus REY15A
Brite
Enzymes [BR:sir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SiRe_1521
Transfer RNA biogenesis [BR:sir03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    SiRe_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418259..1419680
Genome map
AA seq 473 aa AA seqDB search
MQVIRKPTRMLSGVTIVSIMTHPHSCPHGKCVFCPGGVDVDTPQSYYGREPTLMRAIEND
YDPFHQVQSRLRQYVENGHTPSKVELIIMGGTFLSLPIDYQDWFVTYALEAMNRFPSYDK
PSFVYLEDAQVKNEKAEVRCVGMTIETKPDWAKEWHADQMLRLGATKVELGVQTVYDDIL
KFTNRGHTVKDSIESTRILKDSGFKVVYHVMLGLPKSDPDKDLEAFKTIFSDPNFRPDML
KIYPTLVVETAPLANLWRRGLYKPYGTETLIELISEMYRYIPKWVRVMRIQRDIPANVIL
DGNKKGNLRELVEKKVLEKGIKINEIRFREVGMMWQHRGLLPDHTKIHLYKEVYEASEGT
EIFLSFEDEKEILIGYLRLRIPSNKAHRKEIDGKTAIVRELHVYGIEVPIGSWDELGFQH
RGYGSKLLSEAEKIAREEFDMRKISVLSGIGAREYYAKRGYVKEGPYMSKQLI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaataaggaaaccaactagaatgctttctggcgttacgatagtatcgataatg
actcacccgcattcttgtccgcatggaaagtgcgtattctgtcccggaggagtagatgtg
gataccccccaaagctactatggtagagaacccactttaatgagggcaatagaaaacgac
tatgatccattccatcaagtacagtcaagattaagacaatatgttgagaatggacatact
ccaagtaaagtagagttaataataatgggtggtactttcctatcattacccatagattat
caagattggtttgtgacctatgccttagaggctatgaatagatttcctagttatgataaa
ccttcttttgtatatttagaagatgcacaagtgaaaaacgaaaaggcagaagtacgttgt
gtaggaatgacgattgaaacgaaaccggattgggctaaggagtggcacgcagatcaaatg
ctaagattaggtgcaaccaaagttgaattaggagtacaaactgtatacgatgacatttta
aagttcaccaataggggtcataccgtaaaagattccatagaatctactagaatactgaag
gattcagggttcaaagtggtctatcatgtaatgcttggtcttcctaaatcagatcctgat
aaggatctggaggcatttaagacaatattttctgatcctaattttaggccggatatgttg
aaaatatatcctaccttagtagttgaaactgcgccgttagcgaatttatggagaagggga
ttatataagccttatggtacggagactttaattgaattaatatctgaaatgtatagatat
attcctaaatgggttagagtgatgagaatacaaagagatattcctgctaatgtaatctta
gatggtaacaaaaagggaaacttaagagaattggtagagaaaaaggtcttggagaaagga
attaagattaatgaaattagatttagggaagttgggatgatgtggcaacataggggatta
ttaccagatcatactaaaattcatctttacaaggaagtttatgaagcaagtgaaggtact
gaaattttcctatcttttgaggatgaaaaagagattttaataggttatttacgattaaga
ataccatcaaataaggctcatagaaaagagatagatggaaagacggccatagtaagagaa
cttcacgtatacgggatagaagtacctataggaagctgggatgaattgggtttccaacat
agggggtatggaagtaagttattaagcgaagctgaaaagattgcgagagaggaattcgat
atgcggaaaatttctgttttatctggaataggtgctcgagaatactatgctaaaagaggc
tatgtaaaagaaggtccttatatgtctaagcagttgatttga

DBGET integrated database retrieval system