KEGG   Sulfolobus islandicus REY15A: SiRe_1558Help
Entry
SiRe_1558         CDS       T01953                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sir00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1448308..1449201)
Genome map
AA seq 297 aa AA seqDB search
MSDGRLLYLNENSRKFAGFNKERSPFVIIGIPMDITSSYRPGSRFAPSSIRESAQYIEFY
SIRNDVDMGEIGFNDVGDIILHPSNVEENISRISSVINYFHENGKITISIGGEHTITAGV
IKGMKREGLCLVSFDAHLDLRDEYMGYRYDHACVMRRISEYGVKIIEVGTRAVSKEEIEY
ARQKGIAFFTPQQVRLLGVKETSRRIITSIQECKSLYISVDMDGIDPAYAPGVATPEPDG
LDPSTLLDIINLIADKRVIGFDVVEVSPSYDTSGITSVLASRIILEIAATVYKSRSL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacggaagattactttatttaaatgagaatagtaggaaatttgctggatttaac
aaggaaagatcaccctttgtaataattggaatacccatggacattacaagtagctatagg
ccaggaagtagatttgctccatcttcaataagagaatcagctcaatatattgaattttat
tcaataaggaatgatgtggatatgggcgaaataggtttcaatgatgtaggtgatataatt
ctacacccttcaaacgttgaggagaacataagtaggatatcaagtgtgataaattatttc
cacgaaaacgggaaaattactatttccataggtggggagcacacgataactgcgggagtg
ataaaaggaatgaaaagggaaggattatgtttagtcagttttgatgcacatttagattta
agagatgaatacatgggatatagatacgatcacgcttgtgttatgaggaggatatctgaa
tatggcgtcaaaattattgaagtggggactagggcagttagtaaggaggaaatagaatac
gctagacaaaaggggatagcattttttacacctcagcaagttagacttttaggggttaag
gagacttcaagaagaataattacctcaatacaagaatgtaaatcgctctatatctcagtt
gatatggatgggatagatccagcttacgcaccaggtgttgcaacaccagagccagatgga
ttagacccatctactttattggatataattaacttaattgcagataaaagagttatagga
tttgatgttgtggaagtttctccttcttatgacacttcaggtataactagtgtactagct
tctagaataattctggaaatcgctgcaacggtttataagtctagatcgctttaa

DBGET integrated database retrieval system