KEGG   Sulfolobus islandicus REY15A: SiRe_1635Help
Entry
SiRe_1635         CDS       T01953                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00790  Folate biosynthesis
sir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SiRe_1635
Enzymes [BR:sir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SiRe_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ADX85699
UniProt: F0NHW0
Position
complement(1522234..1522860)
Genome map
AA seq 208 aa AA seqDB search
MQKTELDDQKLVEEIARRIREILELLGENPEREGLKETPERVAKALLEMTSGLRTPPPQI
KVFSLGEDGEVYEKNQIVLIKDVNFSSLCEHHMLPIIGKIHVAYIVSNSGKVAGFSKIIR
IVNYYSSRLQIQERLVEQIADAIMNSEIKPKGVMVIGNAIHMCSYVRGVKDKEAKLVSVA
YRGLFKTNRALQNHVFRLLDNANKVNLL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacagaattagatgaccaaaaactagtagaagaaatagctagaaggattaga
gaaattctcgaactactgggtgagaatccggaaagagaagggcttaaagagacacctgaa
agagtagcaaaggctttattagaaatgacctcaggattgagaacgccaccccctcaaata
aaggtattcagtttaggcgaagatggtgaagtatacgaaaagaaccaaatagtactaata
aaagacgttaacttttcgtcattgtgtgagcatcatatgttgccaatcattggaaaaatt
catgtagcgtacattgttagtaatagtggcaaggttgctggttttagcaaaataattaga
attgtaaattattactcatcccgtcttcaaattcaagagaggttagtagagcaaatagct
gatgctataatgaatagcgaaataaaacctaaaggtgttatggtgatcgggaacgcaata
catatgtgttcatatgtcagaggagtaaaggataaagaggccaagttagtttcagtagca
tacagagggctgtttaagactaatagagctttacaaaatcatgtcttcaggttactcgat
aatgcaaataaggtaaacttattatag

DBGET integrated database retrieval system