KEGG   Sulfolobus islandicus REY15A: SiRe_1711Help
Entry
SiRe_1711         CDS       T01953                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SiRe_1711
   01230 Biosynthesis of amino acids
    SiRe_1711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_1711
   00030 Pentose phosphate pathway
    SiRe_1711
   00051 Fructose and mannose metabolism
    SiRe_1711
  Energy metabolism
   00680 Methane metabolism
    SiRe_1711
Enzymes [BR:sir01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SiRe_1711
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SiRe_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587158..1588306
Genome map
AA seq 382 aa AA seqDB search
MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNVISDYYITYVGDDLQLIMTH
NRGELDTKVHETAWNAFKEAAKVAKDLGLYAAGQDLLSDSFSGNLRGMGPGIAEMEFEER
PAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHEGYKFEVLDVYEGESIIL
NTPEETYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLNLIAGKYVGKDDPVMVVRA
QHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDARATRFDGPPRLVGLGFNIKN
GKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRLEPQEMEYTTLPLVIEKLKNR
FKKETDMYKTKPSVYSHESSHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacacttagtgtgatcaaagccgatataggaagcctagctggacatcatgtt
gttcatcctgatactatagctgcagctaataagatattagcagaagctaaaaggaataac
gtaatttccgattattacataacttatgttggagacgatttacaattaataatgactcat
aatagaggagaactagatactaaagttcatgaaacagcctggaatgcctttaaagaagct
gcgaaagtagctaaggatttaggattatatgctgcagggcaagatttgctttcagattct
ttttctggcaatcttagaggaatgggtcctggaattgctgaaatggaatttgaggagaga
cctgctgaaccagtggttatttttatggctgataagactgagcctggtgcatataatcta
ccattatataaaatatttgcagacccattcaatactgctgggctagtaatagatccaaca
atgcatgaaggatataaatttgaagttttagatgtatatgaaggagagtcaataatttta
aacacaccagaagagacttacgatctacttgcgttaataggaacccctagcaggtacatt
gttagaagagtttatagaaaggccgataatttacaagcctcagttgtttctgtagaaaga
ttgaatctaatagctggcaaatacgtaggcaaagacgatccagttatggtagtaagagct
caacacggtttgcctgcgttaggagaaatcttagaagcatttacagtaccttatttggta
ccggggtggatgagaggtagtcactatggacctcttatgccagtatcacaaaaggatgcg
agagccacaaggttcgatggtcctcctaggttagtaggtttaggatttaacatcaaaaat
gggaaactagtagggcctactgatttatttgatgatcctgcatttgatgaggtaaggaga
acagctgtaataattgcagattacattaggaaacatggcccatttatgcctcatagatta
gagccacaagaaatggagtacaccacactcccattagtaatagagaagttgaagaataga
tttaagaaagagacagatatgtataaaactaaaccaagcgtatattcacacgaaagttcg
catgaataa

DBGET integrated database retrieval system