KEGG   Sulfolobus islandicus REY15A: SiRe_1800Help
Entry
SiRe_1800         CDS       T01953                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_1800
   00030 Pentose phosphate pathway
    SiRe_1800
   00051 Fructose and mannose metabolism
    SiRe_1800
   00052 Galactose metabolism
    SiRe_1800
   00500 Starch and sucrose metabolism
    SiRe_1800
   00520 Amino sugar and nucleotide sugar metabolism
    SiRe_1800
  Nucleotide metabolism
   00230 Purine metabolism
    SiRe_1800
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SiRe_1800
Enzymes [BR:sir01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SiRe_1800
    5.4.2.8  phosphomannomutase
     SiRe_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1666497..1667864
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTDGIRGVTNTELQPEFALKLGKAIGTYFGKGARILIGRDVRAGGDMLLKAVESG
LLSSGVLVYEAGMAPTPAFQYGVKTLGYDGGIIITASHNPAEYNGIKVLSPHGIEIARED
EDKIEDIYFNNKFHVVEWNGLVNDVKREDKVIETYVQGILSHVDADKIRSKKYKVLIDPA
NSVGTLATPIVARELGCKVFTINGNLDPLFSARTPEPTFESLSETAKVAKQLGVDLAVAH
DGDADRAIFIDSMGRVQWGDRSGTLLSYWASIKAPNLPKRIFTAVSSSSLVEEYLKQYNI
EVKWTKVGSVDIAHTLFKEKGVAGFEENGGFMYPPHQAVRDGAMSFALMLEMMASENENS
TELFNRLPVYYLVKTKVRITEKSNINKIYDEIIDKYGKYGNIVTIDGVKIISNDFWLLVR
KSGTEPIIRILVEAKDENKSKELAKELEKLVSELA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttatttgggacggatggaataagaggagttactaatactgaattgcaacca
gaatttgcgttaaaattaggaaaagctataggaacatatttcggtaaaggtgctagaatt
ctaataggcagggatgtaagagctggaggagatatgttacttaaagccgttgagagtgga
ttgttaagtagtggcgtattggtctatgaagctgggatggctcctactccagctttccag
tacggtgtgaaaactttaggatatgacggtggtattataataaccgctagtcataatcca
gctgaatataatggtatcaaagtcctttctccacatggtattgagatagctagggaagac
gaggataaaatagaagatatatactttaataataaatttcatgtagtagaatggaatggt
ttagtaaatgatgtaaaaagagaagataaagttattgaaacttacgtgcaagggatactc
tctcatgttgatgctgataaaattaggagtaaaaagtataaggttctcatagaccctgct
aatagtgtaggtacattggcaacaccaattgttgcgagggagttgggatgtaaagttttt
actatcaatgggaatttagatcctctattttcagctagaacaccagaacccacatttgag
agtcttagtgagactgcaaaagttgctaaacaactaggcgtggatttggcagtagctcat
gatggtgacgcggatagggcaattttcatagactccatggggagagttcaatggggtgat
agaagcggtactttattgtcatattgggcttcgataaaagctccaaatctacctaagcgt
atatttactgcagtttctagctctagcttagttgaagaatatctaaaacagtacaatata
gaggttaagtggactaaggtaggtagtgtagacattgcacatacgctatttaaggaaaaa
ggagtagcgggatttgaggaaaatggtggatttatgtatcctcctcatcaagcagtaaga
gacggtgcaatgtcattcgctttaatgctggaaatgatggcatctgagaatgaaaactct
actgaactatttaatagactccctgtttattatttagtgaaaacaaaagtaagaattacg
gaaaagagtaatataaataagatttatgacgaaataatagataagtacggaaagtacggg
aatatagttacaatagatggtgttaagattattagcaacgatttctggctcctagttagg
aagagtggtacagagccaataataagaatattagtcgaggcaaaagatgagaataaatca
aaagaattagctaaagagttagaaaagttagtgagtgagttagcgtga

DBGET integrated database retrieval system