KEGG   Sulfolobus islandicus REY15A: SiRe_2355Help
Entry
SiRe_2355         CDS       T01953                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SiRe_2355
Enzymes [BR:sir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SiRe_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2195749..2196666)
Genome map
AA seq 305 aa AA seqDB search
MRQIDALKSPRFTQISTFGRLPICGRDEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGS
RLLRPYNQFLDTYPFDKLNACDMGDINIIPGYIEDTMNIIQTNLYEIISSKNLVPFIAGG
DHSITLPVLRALNKKYGKINIIHLDSHYDFWDSYWGKKHTHGTWLRRAIEEGLIKEAIQG
GIRASTFSKEDLKDKERLGVKSFTIRDLKYNLDSVIREINSLSGPTHVSIDIDVVDPAFA
PGTGTPEVGGLTSFEIIEIIRKLRFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSV
LSLNL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaatagacgcgttaaaatctccacgcttcacacaaatttctaccttcggtaga
ttaccaatttgcggaagagatgaggaaataaaggcggcgtttttaggaatacctttcgat
gatgctgtaacttatagaccgggagccagatttggaccaatgggaataagacaaggatct
agattattaagaccttacaatcaattcctagatacttatccttttgataagcttaacgct
tgtgatatgggtgatataaacattattccggggtacattgaggatacaatgaacataata
caaacgaatctttatgaaataatatcatcaaaaaacctagtgccctttatagctggtgga
gatcactcaatcacgttacccgttttaagggctttaaataagaagtatggaaaaataaat
atcatacacttggattcacattacgacttctgggattcctattggggtaagaaacatacg
catggtacgtggttgaggagggcaattgaagagggcttaatcaaagaagctatacaagga
ggaattagggcctcaacgttctcgaaagaagatcttaaagataaggagaggttaggagtg
aagagtttcacaattagagatttaaagtataatttagattctgttataagggaaataaat
tccctatctggtcccacacacgtttccattgatatagatgttgtagatccggcgtttgcc
cctgggactggtacgccagaagtgggtggtttgacaagcttcgaaattatagaaattatc
agaaagctgagatttgataaactagttggatttgatgttgtagaagttgccccaccatat
gatgtaagcgaaatcaccacaatgttagctgcgaatattatctatgaaggaatgagcgta
ctctcactaaatctttaa

DBGET integrated database retrieval system