KEGG   Sulfolobus islandicus REY15A: SiRe_2381Help
Entry
SiRe_2381         CDS       T01953                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sir  Sulfolobus islandicus REY15A
Pathway
sir00010  Glycolysis / Gluconeogenesis
sir00020  Citrate cycle (TCA cycle)
sir00620  Pyruvate metabolism
sir00640  Propanoate metabolism
sir00650  Butanoate metabolism
sir00680  Methane metabolism
sir00720  Carbon fixation pathways in prokaryotes
sir01100  Metabolic pathways
sir01120  Microbial metabolism in diverse environments
sir01130  Biosynthesis of antibiotics
sir01200  Carbon metabolism
Module
sir_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiRe_2381
   00020 Citrate cycle (TCA cycle)
    SiRe_2381
   00620 Pyruvate metabolism
    SiRe_2381
   00640 Propanoate metabolism
    SiRe_2381
   00650 Butanoate metabolism
    SiRe_2381
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiRe_2381
   00680 Methane metabolism
    SiRe_2381
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SiRe_2381
Enzymes [BR:sir01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SiRe_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_15 Fer4_17 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADX86430
UniProt: F0NFP4
Position
complement(2220525..2220788)
Genome map
AA seq 87 aa AA seqDB search
MSLLEYQYFPVTRPNKGAGGRTGAWRIVKPVVDYNKCIGCKVCFMFCPESTIVPSNGKVR
VDYEYCKGCGVCANVCPVKAISMVNEQ
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcttgaatatcaatactttcctgtaactagacccaataagggtgctggagga
agaactggagcatggagaatagtaaaacctgttgttgattataacaagtgcataggctgt
aaagtgtgttttatgttttgcccagaatccacaatagtccctagcaatggtaaggtaaga
gtggattatgagtattgcaaaggctgtggagtttgtgccaatgtatgcccagttaaggct
ataagtatggtgaatgagcaatga

DBGET integrated database retrieval system