KEGG   Sulfolobus islandicus REY15A: SiRe_2607Help
Entry
SiRe_2607         CDS       T01953                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase, Pcm
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sir  Sulfolobus islandicus REY15A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2439836..2440546)
Genome map
AA seq 236 aa AA seqDB search
MSAKEDLLRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYIDKPFYVTPNITTTALSL
GIYILDILNLEENQKVLEIGTGIGYYTALIAEVVGENNVVSIEIDDTMFEYAKNVLLIRY
PLIKLIKMDGSLGYEREAPYDRIVIWAAAPTIPCKLYEQLKENGIMVAPIGSEKAQGLYR
ITRIGYEPKIERIGDVIFMKMRGLFGFYEDDDPNERRIKKIEEKVNRLLSKFMNQS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaaagaagacttattaagatctataaaaaattcaaagttggctaatgcattt
atcaaggttaatagagaagactttttgccgcaactattgaagaaatacgcatatgaccca
aattatatagataaacccttttacgtgacacctaacattacgacaacggcgctaagttta
ggcatatatattcttgatattcttaatttagaagaaaatcagaaggttttagagataggt
actggtataggttattacacagcactgatagctgaagtagttggtgagaataatgttgta
tctatcgaaatcgatgatacgatgtttgagtacgctaaaaatgttcttctgatcagatac
cccctaattaaattaattaagatggatggaagtttaggatatgagagagaggctccttat
gaccgaatcgtaatatgggctgctgcgccgactataccttgtaagttatacgagcaactt
aaggaaaacgggatcatggtagcaccaataggtagtgaaaaagcccaaggtctttatagg
attactagaattggctacgagcctaagatagaaagaattggggatgtaatatttatgaaa
atgagaggcttatttggattttacgaggatgatgatccaaatgagaggagaataaagaaa
atagaagaaaaggtaaataggttgctgtccaaattcatgaatcaaagctag

DBGET integrated database retrieval system