KEGG   Sulfolobus islandicus L.S.2.15: LS215_0304Help
Entry
LS215_0304        CDS       T00889                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00020  Citrate cycle (TCA cycle)
sis00640  Propanoate metabolism
sis00660  C5-Branched dibasic acid metabolism
sis00720  Carbon fixation pathways in prokaryotes
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01120  Microbial metabolism in diverse environments
sis01130  Biosynthesis of antibiotics
sis01200  Carbon metabolism
Module
sis_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sis_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LS215_0304
   00640 Propanoate metabolism
    LS215_0304
   00660 C5-Branched dibasic acid metabolism
    LS215_0304
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LS215_0304
Enzymes [BR:sis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LS215_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 PRY
Motif
Other DBs
NCBI-ProteinID: ACP34457
JGI: LS215_0304
UniProt: C3MKT2
Position
complement(252841..253854)
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKSLFKRVGIPVPNGVVTSEPIRWQGKAVVKSQLLEGARGKRGLVRVTEDIYN
TILELKKLGVEKFLVEEFVPHEKEIYASVLLDRETAEPMLVLSREGGIDVEQAKDVKKMI
IPLERGVRSYDIVEAEKYLGVKGLGQIIQGLYKLFVDYDAELVEINPLALTNDGRILALD
SKVILEDNALYRHEDLLKELGRQEVRDSYVELEGDIGIIGNGAGLTMASMDLVKLNGGNP
ANFLDVGGGANREHVKESVLKVGSNPRVKKIVINIYGGITRCDEVALGIIDALKEVKKPI
FVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgaatatgagggaaagagtctttttaagcgtgtagggataccagtgcct
aatggtgttgtaacttctgaaccaataagatggcaaggaaaagctgtagtgaaatctcaa
ctattggaaggcgctagaggtaaaagaggattagtaagagtaactgaagacatttataat
actattttagaactgaaaaaactaggagtcgagaaattcttagtagaggaatttgttcct
cacgagaaggagatttacgcttcagtattgttagatagggaaactgcggaaccaatgtta
gttttatcaagagaaggaggcattgatgttgaacaagctaaggacgttaagaagatgata
ataccactagagaggggagttaggagttatgatattgttgaggctgagaagtatctagga
gttaagggattaggacaaataatacaaggtttgtataaattatttgtagattacgacgct
gaactagttgagataaacccattagcattgactaatgatggtagaatattagctttagac
tctaaagtgattttagaggataacgcgttatatagacatgaggatttgttaaaggagtta
gggaggcaagaagttcgtgatagttatgtggaactagagggagatataggaataataggc
aatggtgcaggattaaccatggcttcaatggatctagttaaattaaatggcggaaatcca
gcaaatttcttggatgttggtggaggagctaatagggaacatgttaaagaaagtgttctc
aaagtgggtagcaatcctagagtcaaaaagattgttataaatatttacggtggaattact
agatgtgatgaggtagcgttaggtataattgatgcgctaaaggaggtgaagaagccaata
tttgttagattattaggaactaacgaggaattagggaagaaaatattaagagagaacggt
gtaaacgtatatgatgatgtattaaaaatgataggtgatgcagtacgctcataa

DBGET integrated database retrieval system