KEGG   Sulfolobus islandicus L.S.2.15: LS215_0432Help
Entry
LS215_0432        CDS       T00889                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00010  Glycolysis / Gluconeogenesis
sis00071  Fatty acid degradation
sis00350  Tyrosine metabolism
sis00625  Chloroalkane and chloroalkene degradation
sis00626  Naphthalene degradation
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01120  Microbial metabolism in diverse environments
sis01130  Biosynthesis of antibiotics
sis01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LS215_0432
  Lipid metabolism
   00071 Fatty acid degradation
    LS215_0432
  Amino acid metabolism
   00350 Tyrosine metabolism
    LS215_0432
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LS215_0432
   00626 Naphthalene degradation
    LS215_0432
Enzymes [BR:sis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LS215_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_31 Methyltransf_25 Methyltransf_12 TrkA_N MTS DapB_N Methyltransf_11 Methyltransf_32 Methyltransf_4 Urocanase DOT1
Motif
Other DBs
NCBI-ProteinID: ACP34561
JGI: LS215_0432
UniProt: C3MLG3
Position
366645..367688
Genome map
AA seq 347 aa AA seqDB search
MRAVRLVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGV
KLPVTLGHEIAGKIEEMGDEVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGI
NFDGAYAEYVLIPHYKYMFKLRRLNAVEASPLTCSGITTYRAVRKASLDPTKTLVVVGAG
GGLGTMAVQIAKAVGGATIIGVDVREEAVETAKRAGADYVINASVQDPLAEIRRITEGKG
IDAVIDLNNSEKTLSVYPKALAKQGKYIMVGLFGADLHFHAPLITLSEIQFVGSLVGNQS
DFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAVGRQVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttagattagtagaaataggaaaacctctcgttttaaaagatatagatata
cctaaacctaagggagcacaagttttgataaaggtagaggctgcgggagtttgtcattct
gatgttcacatgagacaagggagatttgggaatttaagaatagtagaagatttgggtgtg
aaattgccggtaactttaggtcacgagatcgcaggaaaaatagaggaaatgggagatgaa
gttgttggatactctaagggtgatctagttgcagttaacccttggcagggagaaggaaat
tgctattattgtagaataggggaagagcatttgtgcgattctcctagatggttaggaatt
aactttgatggagcttacgcagaatatgtgttaatacctcattataaatatatgttcaag
ctgagaagacttaatgccgtagaagcatcacctttaacttgttctggaataactacatat
agggcagttagaaaagcatcattagacccaactaagacattagtagtagtaggggctggt
ggcggtctaggaacaatggcggtacagattgctaaagctgtcggtggtgcaacgataata
ggtgtagatgtgagagaggaggcagtagagactgctaagagagctggagccgattacgta
ataaatgcgtcagttcaagatcccttagcggaaataaggagaataaccgaaggtaaggga
atcgacgctgtaatagacctaaataactctgagaaaacgctttcagtttatccaaaagct
ttggcaaaacaaggtaagtacataatggtgggattattcggagcggatttgcattttcac
gcaccattaataactttgtcagaaatacaattcgtaggcagtttagttggaaaccaatca
gactttttggggataatgagattagcagaggctggtaaagttaaaccaatgataactaag
accatgaaactagaagaggcaaatgaggcgattgataatctagagaattttaaagctgtc
ggaagacaagtacttataccataa

DBGET integrated database retrieval system