KEGG   Sulfolobus islandicus L.S.2.15: LS215_0753Help
Entry
LS215_0753        CDS       T00889                                 

Definition
AMP-dependent synthetase and ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LS215_0753
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LS215_0753
   00620 Pyruvate metabolism
    LS215_0753
   00640 Propanoate metabolism
    LS215_0753
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LS215_0753
   00680 Methane metabolism
    LS215_0753
Enzymes [BR:sis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LS215_0753
Lipid biosynthesis proteins [BR:sis01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LS215_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
662700..664451
Genome map
AA seq 583 aa AA seqDB search
MWERKRYINRRGILLYMRNMVEIIRDKKIILRPNLENYEEVRKNFSWSKVREELNYNGDV
NAAELAIHKKGELGDKYGILWVSEEEEKRKYTFRDLERRGATFRRVLEDNGIRSGDRVVI
MSKRVPALYFSFIAIGMLGSVILPIFSTFGEDAIRYRVENSGAKVAIVHESLVEKFRNIH
GIKILKITDDGIEGESNRGVEISYTKRSINDPFLILYTSGTTGKPKGIWHSQDILTFYYV
SGKYHFDMHPQDVFWHTGDPAWVAGFAGVWTAWVNGIPLVSYEGRFKAETWYSNIQEYRV
SVISTAPTALRLLKKEGLELAKKYDLSSVRFVHAGGEYVDPDTVKAGIEIFGVPVHDGYG
QTETATYVIANFISTPIKIGSMGKPLPGVEAVIVDENGNPLPPNTQGILALKPDFPAMAR
GIWGDEERWKRNFKNGYYLTGDTAYVDEDGYFWYLGRSDDVIKVSGYRVSPIEIESVIAT
HPAVAEAGVIALEDPVRGHKIKAYIVLKKNYEPSEELKQQIQNYVRERLAAHMVPREIEF
VSELPHTLSGKIMRRVLKAMESGREVGDISTLENPEIVKKSKK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaagaaaaagatatataaataggagaggtattttattgtatatgaggaacatg
gtagagattataagggataagaagataattttaagacctaatctggaaaactatgaggaa
gttaggaagaactttagttggagtaaggtaagagaagagttaaattataatggtgatgtc
aacgcagcagaactggcaatacataagaaaggtgaactaggagataaatacggtatccta
tgggttagtgaggaggaagaaaaaaggaaatacacttttagagatttggaaaggagaggt
gctacattcagaagagttttggaggataatgggataaggagtggcgatagggtagtaatt
atgtctaaaagggtcccagcgctctacttctcctttatagcaataggaatgttgggtagc
gttatacttcccattttctccacatttggtgaagacgcaataaggtatagggttgaaaat
agcggtgctaaagttgcaatagtgcatgagtcgttagtggaaaagtttaggaacattcat
gggattaagattttgaagattacagatgacggcatagagggagagagcaataggggagtc
gagatttcatacactaagaggtctattaatgatccatttttgatcttatatacctctggg
actacaggaaagcctaaaggtatttggcactctcaagatatattgacgttttactatgta
tcgggtaaatatcatttcgatatgcatccccaagatgtcttctggcatactggagaccct
gcgtgggtagctggatttgctggagtttggaccgcgtgggttaatggtataccattagtc
tcctatgagggcaggtttaaagctgagacgtggtatagtaatattcaagagtatagggtt
tcagtaatttcaactgccccaactgccttgaggttgttgaagaaggagggattagaatta
gccaaaaagtacgatctctcctcagttagatttgtccacgctggaggagagtatgttgat
cctgataccgtgaaagcgggaattgagatattcggtgttccagttcacgatggatatggg
caaacggaaactgcaacttacgttatcgctaacttcatttcaacgccgataaaaattggt
tccatgggaaagcccctccctggagttgaagctgtgatagtggacgagaacgggaatccg
cttcctccaaatacacaaggtatactagctctaaagccggattttccagccatggctaga
ggtatatggggagacgaggagaggtggaaacgtaacttcaagaatggatattacttaact
ggagacacagcgtatgttgatgaagatggatacttctggtatttagggagatccgatgac
gtgattaaggtatctggatatagggttagtccaatagagatagagagtgtaattgcgact
catcctgctgtggcggaagctggagttatagctttagaggatccagttagagggcataag
atcaaggcatatatagttctcaagaagaactatgaaccatctgaagagcttaaacaacag
atccaaaactacgttagggagagattagctgctcacatggtacctagggaaatagagttt
gtaagcgaattacctcatacattgagtggaaaaataatgaggagagtattgaaggctatg
gaaagtggtagggaggtaggtgatattagcactttagaaaacccagaaattgtaaagaaa
tcaaaaaaataa

DBGET integrated database retrieval system