KEGG   Sulfolobus islandicus L.S.2.15: LS215_0774Help
Entry
LS215_0774        CDS       T00889                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00010  Glycolysis / Gluconeogenesis
sis00020  Citrate cycle (TCA cycle)
sis00620  Pyruvate metabolism
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01120  Microbial metabolism in diverse environments
sis01130  Biosynthesis of antibiotics
sis01200  Carbon metabolism
Module
sis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LS215_0774
   00020 Citrate cycle (TCA cycle)
    LS215_0774
   00620 Pyruvate metabolism
    LS215_0774
Enzymes [BR:sis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LS215_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT Peptidase_M23 DUF530 Transferase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ACP34838
JGI: LS215_0774
UniProt: C3MMZ8
Position
complement(685251..686435)
Genome map
AA seq 394 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTAVKAAASGILLKIY
AKEGEEVPVGQIIAYIGEIGEKPPSLSTRPTLVSEQQQGQPTRIEEAKAISEVRASPRAR
RLAKEKGIDLVKIKGTGPGGMITEDDVIRELENIEKGVKFTATGLRVKEVIPMTAIRQEI
SRRMVQSLQTMAQVTLNIEINADSLVKIKNEVESKYSMKITYTDVLVKVVAKLIRSHPFL
NATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPITEIVKESHELADKARENKLN
PDEVTGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRKAPVVIGDNISIGYVMWLSL
TFDHRVLDGHTAAKFLKELTEILEDGNKLRAFLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaggtattaatgccaaagttaggtttaaccatgactaaagggaaaatagtt
caatggaagaaaaaagaaggagatagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactgcagtaaaagcagcagctagcggtatcttacttaagatttac
gctaaagaaggtgaagaggtacctgttggtcaaataatagcgtacataggtgaaattgga
gaaaaacccccatccttatctactagacccactttggttagtgaacagcaacaagggcaa
ccaactcgaattgaagaggctaaagcaataagtgaagtaagagcttcacctagagctaga
aggcttgctaaagaaaaaggaatagatctagttaaaataaaggggactggacctggaggt
atgataacagaagatgatgtaattagagagttagaaaatattgaaaaaggagtgaaattc
actgccactggtcttagagttaaagaagtgataccaatgactgcaataaggcaagaaata
agtagaagaatggttcagagccttcagacaatggcccaagtgacactaaatattgagatt
aatgcagattcgttagttaaaataaaaaatgaagtagagtctaagtatagcatgaaaatc
acttatacagacgttctagttaaagtagtagctaaactcatcagaagtcatccatttcta
aacgcaacactagagggcgatcaaataaagataattgaggatgttaatataggaatagct
gtggctctagatcagggattaatagtaccagtaataaggaacgcagatattaagccaatt
actgaaatagtaaaagaaagtcatgaactagcggataaggctagagaaaacaagttaaat
cccgacgaagtaacaggaggaacgtttacgataagtaatttaggaatgtatgatatagat
tcatttacaccaattataaatcctcctcaaactgctatactgggagtaggtaggataaga
aaggcaccagttgtaataggcgataatatctcaattggctatgttatgtggctaagttta
acatttgatcatagagtgttagatggacataccgctgctaagttcttgaaagagcttact
gaaatattagaggatgggaataaattaagagcgtttttaagttag

DBGET integrated database retrieval system