KEGG   Sulfolobus islandicus L.S.2.15: LS215_0923Help
Entry
LS215_0923        CDS       T00889                                 

Definition
AMP-dependent synthetase and ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LS215_0923
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LS215_0923
   00620 Pyruvate metabolism
    LS215_0923
   00640 Propanoate metabolism
    LS215_0923
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LS215_0923
   00680 Methane metabolism
    LS215_0923
Enzymes [BR:sis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LS215_0923
Lipid biosynthesis proteins [BR:sis01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LS215_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
827175..828671
Genome map
AA seq 498 aa AA seqDB search
MASYEEVRRSFSWSEVIRYLDKNPLDVLTSHDGIAVKRFTKNAMEEISFSDLKRKALRLA
LYLKEFHNIKKGDVIAILASKKIQQIIVLLATLSLGAIYQPLFTAFGPEAIKMRTRDVKP
KIIFCQDDQKDKINDAILFSKFDELLSYGELKEIEKINWDDAIILLYTSGTTGTPKGALI
AKRLFLNTYVYMKYGIGVRENDVFWNPADPGWAYGLYYGIIGPLMFGKTIIFLDEPFNPE
RTMEFMEENKVTNFAFAPTAYRMIAGTVKKKYDLVLERASSAGEPLNPEVIRWFMDKYNV
TIKDHYGQTEVGMVVYNGWGYDAKVKIGSMGLPAPGYEVDIIEDIIAVKRDSPGFHFLGY
LNNPEKTKESFRGDWYLTGDNAYKDEEGYLWFVGRKDDVVKVSGYRIGPFEVESVLLEFP
AVLESAVVADEDPIRGHVLHAYIVLKSGYTPSEELKKEIIDFVNTKYSRHVHLERVDFVD
KLPKTESGKIQRYLLRKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctagttatgaagaagttaggagaagtttttcgtggagtgaggtaattagatattta
gacaagaacccattagacgttttgacttctcatgacggtatagcagttaagagattcact
aagaacgctatggaggagataagcttctcagatcttaaaagaaaggcattaagacttgcc
ttatatctcaaggagtttcataacattaaaaagggtgatgtaatagcaatattagcttca
aagaagattcaacaaatcatagtacttttagcaactctctccctaggagcaatttatcaa
ccattatttactgcatttgggccagaggcaattaagatgaggactagagatgtaaaacca
aaaattatcttttgtcaagatgaccaaaaggataagataaatgatgcaatactcttctcc
aagtttgatgaattattaagttacggtgaattgaaagagattgaaaagataaattgggat
gatgcaataattttactttacacttctggtactacgggaacacctaaaggggccctaatc
gctaagaggctatttcttaacacttatgtctacatgaaatatggtataggtgttagggaa
aatgacgtgttttggaaccccgcagatcctggatgggcttatgggctatattatggtata
ataggaccgctaatgtttgggaaaactataatctttcttgacgaaccatttaacccagaa
aggacaatggagttcatggaggaaaataaggttactaattttgctttcgcacctacggca
tatagaatgatagctggaacggttaagaagaagtatgatttagtattggaaagagcgagt
tctgcaggtgaaccacttaacccagaagttataagatggtttatggataagtacaatgtt
actatcaaggatcattatggacaaactgaagttggaatggtagtttataatggctgggga
tatgacgcaaaagtaaaaatagggagtatgggactacctgcacctggttatgaggtcgat
ataatagaggatattatagctgtcaagagagattctccaggtttccacttcttgggatat
ctaaacaatccagagaagaccaaggaatcatttcgaggcgattggtacttgactggtgat
aatgcgtataaagatgaggaaggatatttatggtttgttggaaggaaggacgatgtggtt
aaggtatctggttacaggataggtccatttgaagttgagagcgtacttctagaatttccc
gcagtactagaatctgctgttgttgccgatgaagatccaatacgaggacatgtattacat
gcttatattgtactcaaaagtggatatactccaagtgaggaactaaagaaggagattatt
gattttgtaaatactaaatattctaggcacgtacatctagaaagggttgactttgttgat
aaattgccaaagactgagagtggtaaaatacaaagatatctacttagaaagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system