KEGG   Sulfolobus islandicus L.S.2.15: LS215_0991Help
Entry
LS215_0991        CDS       T00889                                 

Definition
AMP-dependent synthetase and ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sis01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sis00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sis00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sis00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sis00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sis00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
889711..891534
Genome map
AA seq 607 aa AA seqDB search
MVFNPDKEWIENSNVYKFMVEKNLDKLEDFIKYTYENSEFWDEFVKLINVKFPEPYTKVL
DLSRGKQWPQWFIGGKLNIGDQLRDSSDVFIKWMDESFNTRTVTYSQILNESKSIASWLK
RIGLKKGDRIAIYMPMIPEIVSVMLGAVRAGMILVPLFSGFGPEPIRVRIEDSEAKVIFT
VDKSIRRGKEVGMLRNLEGLNIAKVVLNRGGTKGDFYDYKDVIRTSGDYVENTGTEDPMM
IIYTSGTTGKPKGCVHTHDGFPIKASADIYFQFDLKKDETLMWVTDMGWMMGPWMVFGSL
LLDAKMGMIEGYTGGEVLQKFVEDMKVDVLGVSASLVRALRSQGEVKLNVRLTGNTGEPI
DPESWYWLFNASGKNPIINYSGGTEISGGILGNYVIKKIKPSSFNGPSPGINASVFNEEG
KEAPPNVEGELVILSVWPGMTRGFWRNPERYIETYWSIWKDIWVHGDLAYRDEEGYFYIV
GRSDDTIKVAGKRVGPAEIESMLNSFPNVVESACVGVPDPMKGEKIVCFVVSKVGDIEKD
LIRYTEDKLGKAFAPSEIKIVKELPKTRNAKIMRRLIRAVYLNKPLGDISSLENPSALEE
IKRALIS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggtatttaatccagataaggaatggatagagaatagcaatgtatacaagttcatggtt
gaaaagaacctcgataagctagaagacttcattaaatatacatacgagaattcagaattt
tgggatgagtttgtaaagttaataaacgtgaaatttccagaaccttacacgaaggttcta
gatctaagtaggggaaagcaatggcctcaatggttcatagggggaaagttaaacattggt
gaccaattacgcgatagttctgatgtgtttattaagtggatggatgagagcttcaacact
agaacggtaacctattctcaaatactaaatgagagcaagtcaattgcaagttggttaaag
agaataggtttaaagaaaggagataggattgccatttacatgccaatgataccggaaata
gtatcggtaatgttaggtgcagttagagcagggatgatactcgtacctctattttctggg
tttggcccagagccaataagagttagaatagaggatagtgaggctaaagtaatcttcacg
gtcgataagagcattagaaggggaaaagaagttggtatgttgagaaatctggaaggacta
aatatagctaaggtagtattgaataggggaggtactaagggtgatttttatgactataag
gatgtaataagaactagtggagactatgtagaaaatactggtactgaagacccaatgatg
ataatttacacttctggaactactggaaaacccaagggatgtgttcatactcacgatgga
tttccaataaaggcatctgctgacatttactttcagttcgatctgaaaaaagatgagacc
ttgatgtgggttaccgacatggggtggatgatgggaccgtggatggtatttgggtcactc
ttactagatgctaaaatggggatgattgaagggtatacgggtggggaagtcctacagaaa
ttcgttgaagatatgaaggttgatgttttaggagtctcagctagtctggttagagcgtta
agaagtcaaggtgaagttaaactaaacgttaggctaacaggaaatactggagaaccaatt
gatccagaaagctggtattggctatttaacgctagtggaaagaaccccattataaactat
tctggaggtactgaaatctctggaggtattttagggaattacgttataaagaaaataaag
ccatcttcatttaatggtccttccccgggaattaatgcttcagtatttaatgaggaagga
aaagaagctccaccaaatgttgagggggaattggttatattgagtgtttggccaggtatg
accaggggattttggaggaatcccgagaggtatattgagacttattggtcaatttggaag
gatatatgggttcacggagatttggcttatagagatgaagaagggtatttttatattgtt
ggaagaagtgatgatacgataaaggtcgctggaaagagagtaggtccagctgaaattgaa
agtatgttaaattcctttccaaatgtagttgaatcagcatgtgtcggagttccagatcca
atgaagggagagaaaatagtctgtttcgtagtctcaaaggttggcgatattgaaaaggac
ttgataagatatacagaggataaactgggtaaagcatttgcaccatcagaaataaagatc
gttaaggagttacctaaaactagaaatgcaaaaataatgagaagactgataagggcagta
tacttaaataaacccttaggggatatctcctcactagaaaatccatcagctttagaggaa
ataaagagggccttgattagctga

DBGET integrated database retrieval system