KEGG   Sulfolobus islandicus L.S.2.15: LS215_1003Help
Entry
LS215_1003        CDS       T00889                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LS215_1003
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LS215_1003
   00630 Glyoxylate and dicarboxylate metabolism
    LS215_1003
Enzymes [BR:sis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     LS215_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
904579..907056
Genome map
AA seq 825 aa AA seqDB search
MSFGLKISEEVYQKYSDLFGEKTINDRIVSVEKLIEELAVEFSDEIRRIINKRRQWLESK
DPVTSKGAFPSFDEVFVDADGNKRTFREIIQGMIDNFLGVQSKLRWRLNENVPIPKDAHP
LNNPGLEITGPWYPLSRAYNQINSDVACVMEDEEDASPAWYIPFGSGKTTADVWEGRKNV
KLFLSGKAPNPYYEKGKTYSLNKPRDKWPVIFHRLPGLHLLDFDITLNGKPVPAIIVSAV
IYTLNNYNSLKSAGSGVYFYLPKTQTPDEALVIEKILRRIESKLGLKIGTLKIALLYEEV
NAGRFFPIILWIFRERLIKSNNGRWDYLGSLIEMWLQEKVLPDPQNITMTSPNMMAYQKY
NALMMLLAGAKNGEADSAPVGGMAAVMLYPQTDPFGRNRYNLKALRGMKLDKLRERLIGL
IFVAEDKVEGKVTLEEVINGKVKGKLYDMFRQSWVATKEEAYVEAGSKPLRVSLEELQKI
IDAPVNYIEVEGTKLPTVDSGLTPEERALFQKLGLINERGKITPWVITKEMINTPEKLLF
NKELWGGKDLWHSLYDIPEGDITPEHVQHAFYMAANYGFQLLNGNLAAAIDDYELKQRFM
NDLATYRIFTSWLWSVINRDASFTKDGYIKGSKLTKDGVIPAEDVLKVTKGTKIKDIFEK
LWELHLDWTYEFYKEQDMRAARKIAETFGKTNNTSTVEEVYKVVSEAYRSGPFREMSAKE
AAQKLAKILNADASEIEEELINLAPRFDRAMAPVIMEILMKQMLYPKYIMNSGKILFILS
PLDPERRSKVMDSIFSFRKMVEDKVRKGELDKWVLELYDYVYDNY
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttggccttaaaatctctgaagaggtatatcaaaagtatagtgacctcttcgga
gaaaagaccataaacgataggattgtaagtgtcgaaaaactcattgaagagcttgcagtt
gagttctcggatgagataagaaggattattaataaaaggagacaatggttagaatcaaaa
gatcccgttacctctaagggtgctttcccatccttcgacgaagtttttgtagacgctgat
ggaaataagagaacctttagggaaatcattcaagggatgatagacaatttcctaggagta
cagtcgaagctgaggtggaggttaaatgaaaatgtacctataccaaaagacgcacacccc
cttaataacccgggattagaaatcactggaccttggtatcctctaagtagggcatataat
caaataaattcagacgtggcatgtgttatggaagatgaggaagatgcttcacccgcatgg
tatattccctttggttctggtaaaacaactgctgacgtatgggagggaagaaagaacgta
aaactctttctctccggtaaggctccaaatccttactacgagaaggggaaaacgtatagc
ctaaacaaacctagagataagtggcctgtgatttttcacagacttcctggattgcacctc
ttggattttgacataacgctaaatggtaaaccagtaccggctataattgtttctgccgtc
atatataccctaaataattacaatagcctaaagagcgcaggctctggggtatatttctat
ctgcctaaaacacagacaccggatgaggcattggtaatagaaaagatcttgagaagaatt
gagtctaaactagggcttaagataggtacacttaagatcgctctcctttacgaagaggtt
aatgcgggaagatttttccctataatactgtggatatttcgtgagaggctcattaaatca
aataacggtagatgggactacttgggaagtttaattgagatgtggttacaagagaaagta
cttcccgatccccaaaacattaccatgacctcaccaaacatgatggcttatcaaaagtat
aacgcacttatgatgctattggctggggcaaagaatggtgaagccgattcagctccagta
ggtggtatggcagcagtaatgctttatcctcaaactgatccgttcgggagaaatagatac
aacttaaaggcattaaggggaatgaagttagataagttaagagagaggctaatagggctt
atttttgtagcagaggataaagttgaaggtaaagttactttagaggaggtaattaatggc
aaagtaaagggtaaactttatgatatgtttagacagagttgggttgcaaccaaggaagag
gcttacgtagaggcggggagtaaacctttaagggtaagcctagaggaattacagaaaata
attgatgcaccagttaactatattgaagtagagggaaccaaattacctactgtggatagt
ggactaacaccagaggaaagagcattattccaaaaacttggtctaattaatgaaagagga
aaaataacaccttgggttataactaaggaaatgattaacactcccgaaaagttactattt
aataaggaattatggggtggaaaagacctatggcattcgttatatgacatcccagaggga
gacattacaccggagcatgttcaacacgcattctatatggcagcaaattatggtttccaa
ttgcttaatggtaacttagctgcagcaatagatgattatgaattaaagcaaagattcatg
aatgatctagctacctatagaatattcacttcttggctatggagtgtgataaatagagac
gctagcttcacaaaggatggatatattaagggatcaaagttaactaaggacggtgtaatt
ccagctgaagatgttctaaaggttacaaaggggactaagataaaggacatattcgagaag
ttatgggagttacacttagattggacatatgagttttacaaagaacaagatatgagagca
gctaggaaaatagcggaaacctttggaaagacaaataatacttccacagtagaagaggta
tataaggtagtttccgaggcttataggtcaggtccgtttagagaaatgtcggctaaagaa
gctgcacagaagttggcaaaaattcttaacgctgacgcctctgagatcgaggaagagctt
attaatttagccccaaggtttgacagagctatggctccagtaataatggaaattttaatg
aaacagatgctatatcccaagtacattatgaatagtgggaagattctcttcatactatcg
ccgttagatccagagaggaggtcaaaggtcatggatagtatattctcgtttagaaaaatg
gttgaagataaggtaagaaaaggagaactagataagtgggtattggagttatatgactat
gtttatgataattactga

DBGET integrated database retrieval system