KEGG   Sulfolobus islandicus L.S.2.15: LS215_1018Help
Entry
LS215_1018        CDS       T00889                                 

Definition
nucleotidyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sis00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sis00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sis00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sis00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(925084..925836)
Genome map
AA seq 250 aa AA seqDB search
MHAVITAAGLGTRMLPASKEIPKEMFPIPFNNGFKPIIQIIFEQLYNKGIRDFVIVVGRG
KRVIEDHFTPDYDFVSYLEKVGKEKQARELLTFYSKIEKSNIAFVNQPEPKGFGDAVLRV
EPFINDKFIVVAADTLLREIPDLIPNSFLVTEVEDPRPYGVVILEGDRVIDVEEKPKNPK
SRFIIVPYYMFTYDIFHALREVKCNGELQLTEGIKILLKKGVEFITKRVNDVYDLGSIEN
YIASIKKIIG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcagtaataactgcagctggattaggcactcgaatgttacccgcttctaaagaa
attcctaaggagatgtttccaattccctttaacaatggatttaagccaattatacaaata
atctttgagcaactttataataagggtataagggatttcgttatagttgttggtaggggt
aagagggtaattgaagatcattttacaccagattacgattttgtctcttaccttgaaaaa
gtaggtaaagaaaagcaggcaagggagttattaacattttactctaaaatagagaaaagc
aatatagcatttgtaaatcagcctgaaccaaaaggatttggagatgcggtactgagagta
gaaccttttattaatgataaattcattgtagtagcagcagacactctattaagagagatt
ccagatttaatacctaactcttttctagttactgaagtagaagatcctagaccatatggt
gtagtaatattagagggagatagagttatagatgtcgaggaaaaacctaagaatcctaaa
tcccgttttataatagttccttactatatgtttacatatgatatatttcacgccttaaga
gaagttaagtgtaacggagaattacaacttactgaagggataaaaatattgctgaaaaaa
ggtgtggaatttattacaaaaagagtaaatgatgtttatgatctgggtagtatagagaat
tatattgcatctataaagaaaattattggataa

DBGET integrated database retrieval system