KEGG   Sulfolobus islandicus L.S.2.15: LS215_1135Help
Entry
LS215_1135        CDS       T00889                                 

Definition
medium-chain-fatty-acid--CoA ligase (AlkK-1) (EC:6.2.1.30)
Orthology
K14466  
4-hydroxybutyryl-CoA synthetase (4-hydroxybutyrate-CoA ligase, AMP-forming) [EC:6.2.1.-]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sis01200]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sis00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1057071..1058495
Genome map
AA seq 474 aa AA seqDB search
MSSVKNEYDAIHRELREQGFIRTDYPPNPSEVLWNKKIMTMKREEIDKLKTFRLRRIIKW
AWENIEFYRRFWKSKNFEPDMIKDWRDIAKIPILRKDEIRKDLQQNPPFGTIFHPELANH
IRFVGATSGSTGLPTFQGWGALEMDYFQEAQARYLWTFAEVKPTKVYANYLNMSGFYSWG
PPVVETAMWRCGATVIAGGGETYFSWKNRHNMIFKLWKVDVFATTPWLHRLVGEEAKIEG
WETPFKVLLLHGGAAAENTKKKLFKVHPNAELAISVWGTTDGHMAIEVPSLEGQLVVWED
MEIFDIVDPKTDEPVSGGERGELIATLLNHFTMPLIRYSLGDYVKNDFLTDPDPKYGITH
MRFAEPIPGRVEWMFFVKGKLLLPIYVEDAVNEIPDTTGMFNIFIYDNSMDKLKIRIETR
REQVNSTYDKQAREILASRIGINPDDVEIEWVKPGNTIWTGYKLQVFVDQRKKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagttaaaaacgaatacgatgcaattcatagggaattacgagaacaaggtttt
attagaactgattatcccccaaatccatctgaagtgttatggaataagaagataatgaca
atgaaaagagaggaaatcgataagttaaagacgtttagactaagaaggattataaagtgg
gcatgggaaaacattgagttctatagaaggttttggaaatctaaaaacttcgaaccagac
atgataaaggactggagggatatcgctaaaataccgatattgagaaaagatgaaattagg
aaagacctacagcaaaatcctccatttggtacaattttccatccagaattggctaatcac
ataagatttgttggagcgacttctggctcaactggattacctaccttccaaggatggggg
gctttagaaatggactacttccaagaagcccaggcaaggtacttgtggacttttgccgaa
gttaagccaactaaggtttacgcaaactacctaaacatgagtggcttttatagttggggg
cctccggttgttgagaccgcaatgtggagatgtggggcaactgtcatagctggaggtggt
gagacatacttctcatggaagaatagacacaacatgatcttcaaactatggaaagttgac
gtattcgccacaactccttggctacatagattagtaggagaggaggctaaaattgagggt
tgggaaactcccttcaaggttttgctacttcacggtggtgcagctgctgaaaacactaaa
aagaaattattcaaggttcatccaaatgctgaattagctataagtgtttggggaaccact
gatggacatatggctattgaagttccaagcttagaaggacaattagtagtttgggaggac
atggagatatttgatattgtagaccctaagactgatgaaccagtatctgggggagaaaga
ggtgaactgatagcgaccttgttaaatcactttaccatgcctttaatacgctatagttta
ggagattacgttaagaatgacttcctgaccgatccggatcctaagtatggtataactcac
atgagatttgctgagccaataccaggtagggttgagtggatgttcttcgttaaagggaaa
ctattattgccaatttacgttgaggacgctgtgaatgaaattccagacactactggaatg
tttaacattttcatttacgataatagtatggataaattgaagattagaatagagacaagg
agggaacaggttaattctacttacgataagcaagccagagagatattagcgagcaggatt
gggattaacccagatgacgttgagatagagtgggtaaagcctggaaatacaatatggacg
ggctacaagttgcaagtgtttgttgaccagaggaagaagaaataa

DBGET integrated database retrieval system