KEGG   Sulfolobus islandicus L.S.2.15: LS215_1141Help
Entry
LS215_1141        CDS       T00889                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LS215_1141
Enzymes [BR:sis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LS215_1141
Exosome [BR:sis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LS215_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1063679..1065184
Genome map
AA seq 501 aa AA seqDB search
MNTMSHKFVLALDEGTTSARAILFDSDLNIVNIGQYEFPQHYPQPGYVEHDPEEIWEAQM
LAVKKAISKIDAKQIVAIGITNQRETTVLWDAKSGKPVYNAIVWQDRRTSPITDWLKANY
FKMIKDKTGLVPDPYFSASKIKWILDNVPNVREKAERGEIKFGTLDTYLIWRLTNGKAHV
TDYSNASRTMLFNINKLECDREILELLKIPESILPEVKPSSEIYGYSEALGNLIPISGDA
GDQQAALFGQVAFNVGEIKATYGTGSFILMNIGNNPIRSENLLTTIAWGLEKNKATYALE
GSIFITGAAVQWFRDGLRAIDVSDEIEPLASNVEDNGGVYFVPAFVGLGAPYWDPYARGL
IIGITRGTTKAHIARAILESMAYQTRDVIEVMQKESGISINSLKVDGGAAKDNLLMQFQA
DILGIKVIRPKVMETTSMGVAMLAGLGVGLWNSLEELRSIWKVDKEFIPSMSEEKRRALY
SGWKEAVKRAMGWAKVVGGQV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatgtcacataagtttgttctagccctagatgagggtactacaagtgctagg
gctatactcttcgatagtgacttaaacatagtaaacatagggcaatatgaattcccgcag
cactatcctcaacctggctatgtggaacatgaccctgaggaaatatgggaagctcaaatg
ttagccgtaaaaaaggctataagtaaaatagatgctaaacaaatagtagcaatagggata
acaaaccaaagggagacaacggtattatgggatgctaaaagcggtaaaccggtttacaat
gcaattgtatggcaggatagaagaacttctccaataacggactggctaaaagcaaattac
tttaaaatgataaaggacaaaactgggttagttccagacccttactttagtgcatctaag
ataaagtggatacttgataatgtgcccaatgttagggagaaagcagaaagaggagaaatt
aagttcgggaccctagatacttatttaatctggaggcttactaacggaaaagctcatgta
actgattactctaacgcttctagaacaatgctttttaatataaataaattagaatgtgat
agagaaatcttagaacttctaaaaatacccgaatctatattgccagaggttaaaccatca
agtgaaatttacggttacagtgaggcgttaggaaacttaatacctatatctggggacgca
ggagaccaacaagcagctttattcggtcaagtagcgtttaacgtaggtgagataaaagct
acttatggtaccggtagtttcattttaatgaatataggcaataacccaatacgatcagaa
aacctcttaactacaatagcttggggtcttgagaagaataaggcaacgtatgcattagag
gggagtatattcataactggtgcagctgtacaatggtttagggacggcttacgggcaata
gacgtttcagatgagattgaacctttagcctcaaatgtggaagataatggcggtgtctat
ttcgttccagcttttgttggattgggagctccttactgggatccatatgctagaggtctc
ataataggcataactagaggaactactaaagctcatatagctagggctattttagaatca
atggcctatcaaactagagatgtaattgaggtaatgcaaaaggaatccggcatcagtata
aattcgcttaaggttgacggaggtgcagctaaggataaccttttaatgcaattccaagct
gatatattaggtattaaggtaatcagacctaaagttatggaaactacttctatgggagtt
gcaatgctagcaggtttaggtgtaggcttatggaactctttagaggaattaaggagcata
tggaaggttgataaggaattcattccaagtatgagtgaggagaaaaggagggcattgtac
tctgggtggaaggaggctgtaaagagagctatgggatgggctaaagttgtaggaggtcaa
gtttaa

DBGET integrated database retrieval system