KEGG   Sulfolobus islandicus L.S.2.15: LS215_1184Help
Entry
LS215_1184        CDS       T00889                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LS215_1184
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LS215_1184
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LS215_1184
Enzymes [BR:sis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LS215_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1109502..1110791)
Genome map
AA seq 429 aa AA seqDB search
MAMRIRIDLPQDEIPTQWYNILPDLPEELPPPQDPTGKSLELLKEVLPSKVLELEFAKER
YVKIPDEVLERYLQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVY
YAKLDNAKFVTTETGAGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEV
HPSPSDLTEFGRQLLAKDSNHPGSLGIAISDAVEYAHKNGGKYVVGSVVNSDIMFKTIAG
MEAKKQMELIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRKYIASGSSEVPKMT
KGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLMSKGIVQARDY
SQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLG
NYASVLFKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagaataagaatagatttgcctcaagatgaaatacccacacaatggtataat
atcctaccagacttaccggaggaactacccccgccacaagatcccactggcaaatcctta
gaactattgaaggaagttttaccgagcaaggtgctggagttagagttcgctaaggaaaga
tacgtaaaaattccagatgaggttctggagagatatttacaagttggaagaccgactcca
ataattagggcaaaaaggttagaggagtacttaggaaataatatcaaaatctatctgaag
atggagagctacacttacactggttctcacaaaatcaacagtgccttagcacatgtatat
tacgctaaattggataacgcgaaattcgttacgacagaaactggagctggtcagtgggga
tcatcagttgcactagcctcagccctatttaggatgaaagcacacatatttatggttagg
actagctattatgcaaagccttacagaaaatatatgatgcagatgtatggagcggaagtt
catccttctccttcagatttaacagaattcggtagacaattattggccaaagactccaat
catcctggatctttaggcatcgcaataagtgatgcagtagaatatgctcataaaaacggt
ggaaaatacgttgtaggtagtgtggtaaattcagatataatgtttaaaacgattgccgga
atggaggctaagaagcaaatggaactgattggtgaagatccagattacattataggagta
gtaggagggggatcaaattacgcagcattagcttatccattcttaggagatgagctgagg
agtggaaaggttaggaggaagtatattgcctctggatcctcagaagttccaaaaatgact
aagggtgtttataaatacgattatccagacactgcgaaattgttgccaatgctaaaaatg
tacacaatagggtcggacttcgtaccacctccagtttatgcaggtgggctaagatatcat
ggagtagccccaactctcagtctattaatgagcaagggaattgtacaagcaagagattac
tctcaagaggagtcgttcaaatgggctaaattattctcagaactggagggatatatacca
gctccagagacttctcacgcattgccaatattggctgaaatagctgaagaggctaagaag
agcggagaaaggaagacagtactggttagcttctctgggcatggactactagatttgggc
aactacgcctcagtgttatttaaggagtag

DBGET integrated database retrieval system