KEGG   Sulfolobus islandicus L.S.2.15: LS215_1307Help
Entry
LS215_1307        CDS       T00889                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.16)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sis01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sis00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1226936..1228066)
Genome map
AA seq 376 aa AA seqDB search
MVDPAKLLKDLIQIKTANPPGLEYENIALYLKYLFNELGFQIQLIEIPEEYMDKYYIYSP
SHKGNKRLIVIVRNSPNPILHFNFHYDVVPPGDGWLANPFELKIINNKAYGRGTSDMKGS
IVSLYLALSRFNDLPIEITFVPDEESGGIGTKYLTEETRVTPTMVIFGEPSFPNLYVGHF
GIVRGVIKIFGKQAHASNPKDGINAFLLASKLALKLQEKLGKEIVNLGGYTLNPTNSDGI
VPGFFAFSYYRAIPPHDNRTPEFDKNVIDTTAREIGIEYNFEIKSFIPSSVSNPDSGIAK
AFKFCITSALNVVPKELISNIRYDAVFYKNSDSINFGPGNPDQAHVPNEYVELDNIEKTS
VIYECVMKRIYFHNYR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtagatccagcaaaactactgaaagacctaatacaaatcaaaacagctaatccacct
ggattagaatacgagaatattgcactttatcttaaatacctatttaatgagttaggtttt
caaatacagctaatcgaaataccagaggaatacatggacaaatactacatttactctcca
tcacataaagggaacaaaagactaatagtaattgtaagaaacagcccaaatcctatactt
cacttcaactttcactatgacgttgtcccaccaggggatggttggttagcaaatcctttc
gagcttaaaattattaataataaggcatacggaaggggaacctcagatatgaaaggttca
attgtgagcttatatttagccctttctagatttaacgatttaccaatcgagataactttt
gtcccagatgaggaaagtggaggtatagggactaaatacttaacagaggaaactcgtgtt
acccctaccatggtgatatttggtgaacccagtttccctaacttgtatgtagggcatttt
ggtatagtgaggggtgtaataaaaatatttggcaaacaagctcatgcaagcaacccaaaa
gatggtattaatgccttcctgctagcttctaaactagcactcaagttacaagaaaaatta
ggaaaggaaatagttaacctcgggggatatacgcttaatcccactaatagtgatggaata
gtaccgggtttctttgcctttagttattatagagctattcctccacacgacaatagaact
ccagaatttgacaagaatgtaattgacactacagctagagaaatagggatagaatataat
tttgagattaaatcttttattccaagttcagtttctaacccagattctggcatagctaaa
gcgtttaaattttgtatcacttcagctcttaacgtggtacctaaagagctaataagtaat
ataagatatgatgcagtcttctataaaaattccgattcgataaattttggtccaggtaat
ccagatcaagctcatgtacctaatgaatatgttgaattagataacatagagaaaactagt
gtaatttacgaatgtgtgatgaaaaggatttattttcataattatcgataa

DBGET integrated database retrieval system