KEGG   Sulfolobus islandicus L.S.2.15: LS215_1427Help
Entry
LS215_1427        CDS       T00889                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LS215_1427
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LS215_1427
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LS215_1427
Enzymes [BR:sis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LS215_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1341632..1342822
Genome map
AA seq 396 aa AA seqDB search
MKCLSCGYETEIDQDQILCPRCGGLLEIIVEPPKDFSFSKLRGRGVWRYKELIAGKYKNI
VSINEGNTPLIRSSNINDNLFFKFEGLNPTGSFKDRGMTVAVSSAVSLNYKTVIAASTGN
TAASAAAYAARAGIKSFIVLPKGKVALGKLAQSILYGSVILEVDGSFDVAMDAVMRLYKD
LKVVYPLNSFNPWRLEGQKTIAFEIAEELGVPDNVIVPVGNAGNIYAIWKGFNELVKTGV
INTIPRMIGIQAEGASPIATAIVKGKDSPDFVENPDTVATAIRIGKPVNWQKAMKAIRES
NGTAIAVSDSEILDAQKTLARKEGIGAEPASAAALAGYIKAINEKVVDKDEKTVLILTGH
SLKDPDSMTKAEAKRILVNPLHMEKIILGEINGSNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttaagttgtggatatgaaacggaaatagatcaagatcagatattatgtcca
agatgtggaggactattggaaattatagtggaaccaccaaaggacttctctttcagcaaa
ttgagaggaagaggagtttggagatacaaagaactgatagcaggcaaatataaaaatatt
gtaagtataaatgaaggaaataccccgctaataagatcctcaaatataaatgataatctt
ttttttaaattcgaaggacttaatcctactggaagttttaaggatagaggaatgacagta
gcagttagttctgcagtaagcttaaactacaaaaccgtaatagcagcatctactggaaac
actgcagcttccgcagctgcttatgctgcaagagcaggtataaagagctttatcgtctta
cctaaaggtaaggtagcattaggtaaattagctcagtcaatactttatggctcagttatt
ttagaggttgatggaagttttgacgttgctatggatgcggtaatgaggttatataaggat
ttaaaagtagtatatccattaaattcttttaacccatggagattagaaggacagaagaca
atagcatttgagatagcggaagaactaggagttccagataatgtgatagtcccagtaggc
aatgcaggcaatatttacgcaatatggaagggatttaatgagctagttaaaactggagtg
ataaatactattcccagaatgattggaatccaagctgagggagcatcaccaatagctact
gcaatagtcaaaggcaaagattctccagatttcgtagaaaatccagatactgtagctact
gcaataagaataggaaaaccagtaaattggcaaaaagcgatgaaagcaataagagaatcc
aatggaaccgcaatagcagtatctgattctgaaatattagacgcacagaagaccctagct
agaaaagagggcataggagctgagcctgcttcagcagctgccttagctggttacattaag
gcaataaatgaaaaggtagtagataaagatgaaaaaacagttttaatcctaacaggacat
tcattaaaagatcccgatagtatgaccaaagctgaagctaagagaatattagttaatcct
ctacatatggaaaaaattatcctaggtgagataaatggctctaatagttaa

DBGET integrated database retrieval system