KEGG   Sulfolobus islandicus L.S.2.15: LS215_1741Help
Entry
LS215_1741        CDS       T00889                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00260  Glycine, serine and threonine metabolism
sis00750  Vitamin B6 metabolism
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01120  Microbial metabolism in diverse environments
sis01230  Biosynthesis of amino acids
Module
sis_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LS215_1741
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LS215_1741
Enzymes [BR:sis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LS215_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 DFP
Motif
Other DBs
NCBI-ProteinID: ACP35737
JGI: LS215_1741
UniProt: C3MQS4
Position
complement(1599115..1600140)
Genome map
AA seq 341 aa AA seqDB search
MVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNSERGFPYSEKIFPYIKHFISL
GEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAEKGVKQISEDSSGNAGSAIAA
YSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSREDVAKAAENSGYYYASHVLQP
QFRDGIRTLAYEIAKDLDWKIPNYVFIPVSAGTLLLGVYKGFKHLLDSGVISEMPKIVAV
QTEQVMPLCAKFKKISYTPPDKVTSIADALVSTRPFLLDYMVKASSECIVVSDNEIVEAW
KELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGSGLKVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaggtttgtatgaaatgcagaaaggaaagggaaagtatatacgagattaag
tgtaacaaatgcggaggaccattcgagatcctgatagattttgaatttgataagaattct
gagagaggttttccctatagtgaaaagattttcccttacatcaaacatttcatatcccta
ggagagggaagaactccattaattaaaaaggggaacatatggtttaaactcgacttctta
aatccatcaggatcatacaaggatagaggagcagtgactctggtctcttatcttgcggaa
aaaggtgtaaaacaaattagtgaagactcttctggaaatgcaggatcagcaatagctgcg
tattctgcagctgctggtattgaggcatacattttcgttcctgaaacggcaaaaggagga
aaacttaagcaaatagaatcctacggtgctcacgttgttagagtaagggggagtagagaa
gatgtagcaaaagctgcagagaattctggttactattacgcatcacatgttttacaacct
caatttagagatgggattagaactctggcatatgaaattgcaaaggatttagattggaaa
attcctaattatgttttcattccagtatcagcaggaactttacttttaggtgtttataag
gggttcaagcacttgctagattctggtgtcatatcggaaatgcctaaaatcgtagcagtc
caaacagagcaagttatgccactttgtgctaaattcaaaaagatttcttacacaccacca
gacaaggttacctccattgcagacgctttagtatcaactagaccatttctactagattat
atggtaaaggcttctagtgaatgcatagttgtaagcgataatgaaatagtagaagcttgg
aaagaattggctaaaatgggactgctggtagaatatagttctgctactgtatttgctgct
tataagaaatacagtgttaacgatgcagtattagttttaaccggtagcggattaaaggta
ttatga

DBGET integrated database retrieval system