KEGG   Sulfolobus islandicus L.S.2.15: LS215_2117Help
Entry
LS215_2117        CDS       T00889                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00860  Porphyrin and chlorophyll metabolism
sis01100  Metabolic pathways
sis01110  Biosynthesis of secondary metabolites
sis01120  Microbial metabolism in diverse environments
Module
sis_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LS215_2117
Enzymes [BR:sis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LS215_2117
Exosome [BR:sis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LS215_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACP36110
JGI: LS215_2117
UniProt: C3MJ23
Position
complement(1925643..1926653)
Genome map
AA seq 336 aa AA seqDB search
MVTFPFLRPRRLRKNKLVRDLVAETTLFQDDLVLPIFIKESINEPEQITSMPGVYRYPPN
DKLVNYVQDSYENGIRSIILFGIPSYKDEIASSAYDKNGVIQRAVKIIKDSFKDKIIVIT
DECTDEYTSHGHCGLVNYNNGCYVIDNDESLKIHAKIALSQAEAGADIIAPSSMMDGVVK
AIRDALDGAGYNDTLIMSYSVKYASIMYGPFRDAAYSKPAFGDRRGYQMDPRNAFEALKE
ARLDIEEGADILMVKPAHTYLDVIRLVKDHFPEYPLAAYHVSGEYSMIKAAAINGWIDER
TAVLEITTAIKRAGADLIITYYANDIVRWIKEGVPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattcccatttttgagaccaagaagattaagaaaaaacaaattagtaagagat
ctagtagctgaaacgactctttttcaagacgatttagtacttccaatatttataaaggaa
agtataaatgagccagaacaaattacttcaatgccaggagtgtacagatatccaccaaat
gataagttagtcaattatgtacaagatagctatgaaaatggtattcgaagtattatattg
tttggaattccatcttataaagacgagatagcatcatcagcctacgataaaaatggtgta
atacagagggcagttaaaataataaaagatagttttaaggataagattatagtaatcaca
gacgagtgtactgatgagtatacgtctcatggtcattgcggtcttgtgaactataataac
ggatgttatgtaatagataatgatgaaagcctaaagattcatgcaaagattgcattaagc
caagctgaagctggagcagatattatagccccatcaagcatgatggacggtgttgttaag
gctataagagatgcgctagatggagctggttacaatgatacattgataatgtcatacagt
gtaaagtacgcttcaataatgtatggtccttttagggatgcagcttactctaaaccagcg
tttggagataggagagggtatcagatggatcctaggaacgcatttgaagcactaaaagaa
gctagattagatatagaggaaggagctgatattttgatggttaaacctgcccatacatat
ttagatgtaataagattagtaaaagatcacttcccagaatatcccctagcggcatatcat
gtcagtggtgaatatagcatgataaaagcagcagcaattaatggatggatagatgaaagg
actgccgtattggaaattactaccgcaataaaaagagcaggggctgatttaattattact
tattatgctaacgatattgtaagatggataaaggaaggtgtaccattttga

DBGET integrated database retrieval system