KEGG   Sulfolobus islandicus L.S.2.15: LS215_2726Help
Entry
LS215_2726        CDS       T00889                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
sis00010  Glycolysis / Gluconeogenesis
sis00020  Citrate cycle (TCA cycle)
sis00620  Pyruvate metabolism
sis00640  Propanoate metabolism
sis00650  Butanoate metabolism
sis00680  Methane metabolism
sis00720  Carbon fixation pathways in prokaryotes
sis01100  Metabolic pathways
sis01120  Microbial metabolism in diverse environments
sis01130  Biosynthesis of antibiotics
sis01200  Carbon metabolism
Module
sis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LS215_2726
   00020 Citrate cycle (TCA cycle)
    LS215_2726
   00620 Pyruvate metabolism
    LS215_2726
   00640 Propanoate metabolism
    LS215_2726
   00650 Butanoate metabolism
    LS215_2726
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LS215_2726
   00680 Methane metabolism
    LS215_2726
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LS215_2726
Enzymes [BR:sis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LS215_2726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_7 Fer4_9 Fer4_2 Fer4_4 Fer4_16 Fer4_13 Fer4_17 Fer4_15 Fer4_22 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ACP36661
JGI: LS215_2726
UniProt: C3MM27
Position
2506375..2506659
Genome map
AA seq 94 aa AA seqDB search
MNKLVLSMSLLEYQYFPVTRPNKGAGGRTGAWRIVKPVVDYNKCIGCKVCFIFCPESTIV
PSNGKVRVDYEYCKGCGVCANVCPVKAISMVNEQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttggtgttgagtatgtcactgcttgaatatcaatactttcctgtaactaga
cccaataagggtgctggaggaagaactggagcatggagaatagtaaaacctgttgttgat
tataacaagtgcataggctgtaaagtgtgttttatcttttgcccagaatccacaatagtc
cctagcaatggtaaggtaagagtggattatgagtattgcaaaggctgtggagtttgtgcc
aatgtatgcccagttaaggctataagtatggtgaatgagcaatga

DBGET integrated database retrieval system