KEGG   Sulfolobus islandicus L.S.2.15: LS215_2751Help
Entry
LS215_2751        CDS       T00889                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sis  Sulfolobus islandicus L.S.2.15
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sis00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LS215_2751
Enzymes [BR:sis01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     LS215_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2530629..2531546
Genome map
AA seq 305 aa AA seqDB search
MRQIDALKSPRFTQISTFGRLPICGRDEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGS
RLLRPYNQFLDTYPFDKLNACDMGDINIIPGYIEDTMNIIQTNLYEIISSKNLVPFIAGG
DHSITLPVLRALHKKYGKINIIHLDSHYDFWDSYWGKKHTHGTWLRRAIEEGLIKEAIQG
GIRASTFSKEDLKDKERLGVKSFTIRDLKYNLDSVIREINSLSGPTHVSIDIDVVDPAFA
PGTGTPEVGGLTSFEIIEIIRKLRFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSV
LSLNL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaatagacgcgttaaaatctccacgcttcacacaaatttctaccttcggtaga
ttaccaatttgcggaagagatgaggaaataaaggcggcgtttttaggaatacctttcgat
gatgctgtaacttatagaccgggagccagatttggaccaatgggaataagacaaggatct
agattattaagaccttacaatcaattcctagatacttatccttttgataagcttaacgct
tgtgatatgggtgatataaacattattccggggtacattgaggatacaatgaacataata
caaacgaatctttatgaaataatatcatcaaaaaacctagtgccctttatagctggtgga
gatcactcaatcacgttacccgttttaagggctttacataagaagtatggaaaaataaat
atcatacacttggattcacattacgacttctgggattcctattggggtaagaaacatacg
catggtacgtggttgaggagggcaattgaagagggcttaatcaaagaagctatacaagga
ggaattagggcctcaacgttctcgaaagaagatcttaaagataaggagagattaggagtg
aagagtttcacaattagagatttaaagtataatttagattctgttataagggaaataaat
tccctatctggtcccacacacgtttccattgatatagatgttgtagatccggcgtttgcc
cctgggactggtacgccagaagtgggtggtttgacaagcttcgaaattatagaaattatc
agaaagctgagatttgataaactagttggatttgatgttgtagaagttgccccaccatat
gatgtaagcgaaatcaccacaatgttagctgcgaatatcatctatgaaggaatgagcgta
ctctcactaaatctttaa

DBGET integrated database retrieval system