KEGG   Sulfolobus islandicus L.S.2.15: LS215_2879Help
Entry
LS215_2879        CDS       T00889                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sis  Sulfolobus islandicus L.S.2.15
Brite
Enzymes [BR:sis01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LS215_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2656059..2656721)
Genome map
AA seq 220 aa AA seqDB search
MGAKEDLLRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYIDKPFYVTPNITTTALSL
GIYILDILNLEENQKVLEIGTGIGYYTALIAEVVGENNIVSIEIDDTMFEYAKNVLLIRY
PLIKLLKTDGSLGYEKEAPYDRIVVWAAAPTIPCKLYDQLKENGIMVVPIGGEKAQGLYR
ITKTGYEPKIERIGDVIFMKMRGLFGFYDNDDPNERRIKN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaaaagaagacttattaagatctataaaaaattcaaagttggctaatgcattt
atcaaagttaatagagaagactttttgccgcaactattgaaaaaatacgcatatgaccca
aattatatagataaacccttttatgtaacacctaacattacgacaacagcgctaagttta
ggcatatatattcttgatattcttaatttagaagaaaatcagaaggttttagagataggt
actggtataggttattacacagcactgatagctgaagtagttggtgagaataacattgta
tctatcgaaatcgatgatacgatgtttgagtacgctaaaaatgttcttctgatcagatac
cccctaattaaattactgaagacggatggaagtttaggatatgagaaagaggccccttat
gatcggatcgtagtatgggcagctgcaccaactataccttgtaagctatacgatcaactt
aaggaaaacgggatcatggtagtaccaataggaggtgaaaaagcccaaggtctttataga
attactaaaactggttatgagcctaagatagaaagaattggggatgtgatatttatgaaa
atgagaggattatttggattttatgataatgacgatccaaacgagaggagaataaaaaat
tag

DBGET integrated database retrieval system